KEGG   Ensifer adhaerens OV14: OV14_a0258Help
Entry
OV14_a0258        CDS       T03054                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00051  Fructose and mannose metabolism
ead01100  Metabolic pathways
ead01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    OV14_a0258 (fucA)
Enzymes [BR:ead01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     OV14_a0258 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II SsgA
Motif
Other DBs
NCBI-ProteinID: AHK45470
UniProt: W8IA58
Position
2:288224..288919
Genome map
AA seq 231 aa AA seqDB search
MNQPDVLSLRREMVDICRRMNSNGINQGTAGNLSVRIGDGFLVTPSSLAYETMQPEDLVE
MDFKGNYTGLRPSSEWRFHRDILRERTDINVVLHCHSIYATTLACHHKTIPSFHYMTGIA
GGTTIRCAEYATFGTQALSNNALVALKDRTACLLGQHGQISLGKTLESALWMAIEIETLS
RMYVQALTLGEPPVLPDDEMQRVIAQMRRMSYGQAPDDEGVNDLARPRAAS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcccgatgtactctcccttcgccgcgagatggtggatatctgccgccggatg
aattcgaacggcatcaaccaggggacggccggcaacctgtcggtgcgcatcggcgatggc
tttctggtgacgccgtcgtcgctcgcctatgagacgatgcagccggaagatctggtcgag
atggactttaagggcaactacacaggccttcgaccgtcatccgaatggcgtttccatcgc
gacatcctgcgcgagcgcacggatatcaacgtggtgcttcattgccactccatctatgcg
accacgcttgcctgccaccacaaaaccatccccagcttccactatatgaccggcattgcc
ggtggcacgacgatccgctgcgccgaatatgcgacgttcgggacccaggcgctgtccaac
aacgcgctggtggcgctcaaggaccgcaccgcctgcctgctcggtcagcatggtcaaatc
tcgctcggcaagacgctggaatcggcattgtggatggcgatcgaaatcgagaccctctcg
cgcatgtatgtccaggccctcacgctcggcgagccgccggttctgcccgacgacgagatg
cagcgggtgatcgcccagatgcgccggatgagttatggccaggcacctgatgatgagggc
gtcaacgatctcgctcgcccgcgggccgccagttga

DBGET integrated database retrieval system