KEGG   Ensifer adhaerens OV14: OV14_b0061Help
Entry
OV14_b0061        CDS       T03054                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    OV14_b0061 (tdh)
Enzymes [BR:ead01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     OV14_b0061 (tdh)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     OV14_b0061 (tdh)
    1.1.1.-  
     OV14_b0061 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AHK46699
UniProt: W8IHE0
Position
pOV14b:65780..66856
Genome map
AA seq 358 aa AA seqDB search
MRALRFHAARDLRLEQISPPDRNPGPGQVLIRNRFVGICGTDLHEYAYGPIFIPSEPHPF
TGARAPQILGHEFGGIVEAIGDGVNTIAVGDRVSVQPLIMPRSGDYFADRGLYHLSTDLA
LAGLSWQWGGMAEHATLNEYNVQKIPDAMSDEEAALVEPTAVAVYACDRGGVTAGSSVLV
TGAGPIGILTLLAARAAGAAQLFVSDINDARLDFARSILPDLITINPKRDNPGDIVRATS
EGKVGCDVAIECVGNEHALKACVDAVRKQGVVVQTGLHPHENPLDWFQVTFKDIDLRGSW
AYPTHYWPRVIRLIASGLLPAAKVVTSTITLDRAVAQGFDALLDPAGKQLKILIDLTK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcactcagatttcatgcagccagggatctgcggcttgaacagatctcgccaccc
gatcgcaatccggggccaggccaggtcctcatccgcaatcgctttgtcggcatctgtggc
acggacctgcacgaatacgcctatggcccgattttcattccaagcgaaccgcacccgttc
accggcgcgcgggcgccacagattctcgggcacgagttcggtggcatcgtcgaggcgatc
ggcgacggcgtaaacaccattgcggtcggagacagggtatccgttcaaccgctgatcatg
ccgcgatccggcgactactttgccgatcgcggtctttaccacctcagcaccgacctcgcc
ttggcgggcctcagctggcagtggggcgggatggcggaacatgccacgctcaacgaatac
aacgtccagaagatccccgatgcgatgagcgacgaggaggcagcccttgtcgaaccgact
gcggttgccgtctatgcctgcgatcgcggtggcgtgacggcgggaagcagcgtgctcgtc
accggtgccggaccgatcggcatcctgacactgctggcggcaagggcagccggcgcagca
cagctgttcgtctccgacatcaacgatgcgcggctcgatttcgcaagatcgatcctgccc
gatctgatcacgatcaatcccaaacgggacaatcccggcgacatcgttcgggcgacctcg
gaaggcaaggtcggttgcgatgtcgcgatcgaatgcgtcggcaacgaacatgcgctgaaa
gcctgcgtcgatgccgtgcgcaagcagggtgtcgtcgtgcaaacgggtctgcatccgcac
gagaacccgctcgactggttccaggtgaccttcaaggacatcgacctgcgcggatcctgg
gcctacccgacccactactggccgcgcgtcatccggctgatcgcatcgggtctgcttccg
gccgccaaggttgtgacgagcaccatcacgctcgaccgggccgttgcccaaggcttcgac
gccttgctcgatccggccggcaagcaactgaagatcctgatcgaccttacaaaatga

DBGET integrated database retrieval system