KEGG   Ensifer adhaerens OV14: OV14_b0281Help
Entry
OV14_b0281        CDS       T03054                                 

Definition
(GenBank) hypothetical protein
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
ead  Ensifer adhaerens OV14
Brite
KEGG Orthology (KO) [BR:ead00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    OV14_b0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transp_cyt_pur
Motif
Other DBs
NCBI-ProteinID: AHK46860
UniProt: W8IE33
Position
pOV14b:complement(300469..301932)
Genome map
AA seq 487 aa AA seqDB search
MTDHVARGGLSTAEIEREDAARHSAAAERGDAPLLPSERLWGFWEFTYANSALAIATWAF
LIGGAIGLFVGPKEGIAAIVIGNIVGVVLTSLATTCMSGRYGVEQFIALRSQFGYNGSRV
VYVLAVVLLTMGWLAVLAMMFGRSIDGLMALSAGEAANPTGVKMVIAAIGAILVTWFIVA
KGPTSIKFFNMVVSPALVILMGVMLYLILSQRSFSELLALPALDPPFEDNTLNFIVAVEV
NLAAGFSWWPYIGNLARLTKNERTAFWPNILGIFGAAALGEIVGLLAAVSLGESDPTIWM
TKIAGPVIGIIALLFVAFANMTSMANILYTSIVGLRQVGTASVRRIPWGTVLFLFCLIPL
GLVVFYPQMYDGFFIFLVWTSALNSALAGIGIVDYFFLRGQKLDMRSLHGPQQNGPYRFW
AGFNPIGLLALAVGCIVYVVIFNPQTLASLPAFKYLTASIPACVAAGAVHYVLTRLFARG
RGWGQYP
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcatgtcgcccgtggcggtctctcgaccgcagaaatcgaacgcgaggacgcc
gcccgccacagcgccgctgccgagcgcggtgatgcgccgctcctgccctccgagaggctc
tggggcttctgggaattcacctatgccaattcggcgcttgccatcgccacttgggccttc
ctcattggcggcgcgattggcctgttcgtcgggccgaaggaaggtatcgctgcgatcgtc
atcggcaacatcgttggcgtggtgctgacgtcgctcgctaccacctgtatgtccgggcgc
tacggtgtcgaacagttcatcgcgctgcgcagccagttcggctacaacggtagccgcgtt
gtctacgttctggccgtggtgctgctcaccatgggctggctggcggtgctcgccatgatg
ttcggccgctcgatcgacggcctgatggcgctcagcgccggtgaggcggccaatccgact
ggcgtcaagatggtcattgccgcgatcggcgccatcctcgtcacctggttcatcgtcgcc
aagggcccaacctcgatcaagttcttcaacatggttgtgtcaccggccctggtgatcctg
atgggcgtgatgctctacctcatcctcagtcagcggtctttcagcgagcttctggcgctg
ccggcgctcgatccgcccttcgaggacaacacgctgaacttcatcgtcgcggtggaggtc
aatctggccgctggcttctcctggtggccctatatcggcaacctggcgcgcctcaccaag
aacgaacgcaccgccttctggccgaacatcctcggcatcttcggggcggctgcccttggc
gaaatcgtcggtctgcttgcggccgtctcactcggcgaaagcgatccgacgatctggatg
accaagatcgccggcccggtcatcggcatcattgccctgctcttcgtcgccttcgccaac
atgacctcgatggcgaacatcctctacacctccatcgtcgggctgcgccaggtcggcacg
gcgtccgtgcgccgcattccctggggcacggtcctcttcctgttctgcctcatcccgctc
ggcctggtggtgttctatccgcagatgtacgacggcttcttcattttcctcgtctggacc
tcggcgctcaactctgcgctcgccggcatcggcatcgtcgattacttcttcctgcgcggc
cagaagctcgacatgcgcagcctgcatggcccccagcaaaacggtccctaccgcttctgg
gccggcttcaatcccatcgggctcctcgcccttgccgtcggctgcatcgtctacgtcgtc
atcttcaatccgcagacgctcgcgagcctgccggccttcaagtacctgaccgcctccata
cccgcctgtgtcgctgcaggtgcggtccactacgtcctgacccggctcttcgcccgcggg
cgcggctggggccagtatccgtaa

DBGET integrated database retrieval system