KEGG   Ensifer adhaerens OV14: OV14_b0316
Entry
OV14_b0316        CDS       T03054                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00230  Purine metabolism
ead01100  Metabolic pathways
ead01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    OV14_b0316
Enzymes [BR:ead01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     OV14_b0316
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AHK46885
UniProt: W8IE53
Position
pOV14b:complement(338540..340846)
AA seq 768 aa
MNMTTPIEKRDFKIVGKSVRRDDVLEKVTGEAQYTGDVKLPGMLHGKIKRAAIAHARIKS
LDISKALAYPGVKAVLTHETVPRVLHYGSPHPRSASCTKDQYILDDRVRFWGEGVAAVAA
ISEEIADEALDLIEVEYEPLPAVFEPEEAAKPGAPLIHEVGPGGNLVLDPVRVSRGDVEA
GFAEADFVLEGVFSGGRPHPAYMEPNVCIADWDGSNKLTFWTSTQTSFMVRGILAEVLGL
PLTKVRVIVDHMGGGFGAKQDLFQHEFLCALLAKETRRPVKMEFTRHETFVAGRARHPCK
IWLKQGFRNDGTIVARDMKLVYDSGAYGSHGPGVTIVGTTAATSLYRCENVRLEGRCVYT
NTPINGAFRGYGVVQSYYALDIQMDEAAERLGLDPAELKLKNAVRAGDIAPSGHPIIGHG
LEMCIKHGVDVVDWKALRNRDRTPDPKRPHIRKGWGIGCEMHGSSAYPGIKEQGNATVKV
NEDGTVTLLTGAAGLGTGAHTALAQIVAEEIGVRFEDVGIIHGDTDVVPWDIGAFASHTT
YLVGTAAKMAASKVRAAVLERAAMKLQVLPADVDLSEGKVFLITDPTSVMTVAEAMGPSR
GIPAANIVANGTYEPTKSYSFAAHFTEVDVDIDTGIVEVKRVVPVHDVGRVIHPIAAQGQ
IEGGIQQGIGHTLTEDYVIDKTTGRSLNAGLVDYKMPLSMDMPEIETVILEAAPDPGGPW
GAKGVGEDPIIAIGPAIANAIHDAIGVRFRHYPITPEDILKALREKGA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgaacatgacgaccccaatcgaaaagcgcgacttcaaaatcgtcggcaagagtgttcgc
cgcgacgacgtgctcgaaaaagtgacgggcgaggcgcagtataccggcgacgtcaaactg
cccggcatgctgcacggcaagatcaagcgtgcggcaatcgcccatgcccgcatcaagagc
ctcgatatcagcaaggcgctcgcctatcccggtgtcaaggcggtgttgacgcatgagacc
gtgccgcgcgttctgcattacggctcgccacatccccgttcagcctcctgcaccaaggac
cagtatatcctcgacgaccgtgtgcgcttctggggcgagggcgtcgccgccgtggccgcg
atcagcgaggagatcgccgacgaggcgctggacctgatcgaagtcgaatacgagccgttg
ccggcggtgttcgagccagaggaggccgcaaagcctggcgcgccactgatccacgaggtc
gggcctggcggtaacctggtgctcgatccggtgcgcgtcagccgcggcgatgtggaagcc
ggttttgccgaggcggatttcgtgctcgaaggcgtcttttccggcgggcgaccacatccg
gcctacatggagcccaatgtctgcattgccgactgggacggttcgaacaagctcaccttc
tggacctcgacgcagacctcgttcatggtgcgcggcattcttgccgaagtcctcggcctg
ccgctcaccaaggtgcgcgtcatcgtcgaccatatgggcggcggcttcggcgccaagcag
gacctcttccagcacgaattcctctgcgcgctgctcgccaaggaaacgcgtaggccggtg
aagatggaatttacccggcacgagaccttcgttgccggccgcgcccgccatccctgcaag
atctggctgaaacagggtttccgtaacgacggcaccatcgtcgcgcgcgacatgaagctc
gtctacgactccggcgcctacggctcgcacgggccgggagtgacgatcgtcggcaccact
gctgccacctcgctctatcgctgcgagaacgtgcggctggagggacgttgcgtctacacc
aacacgccgatcaatggcgcctttcgcggctatggcgttgtgcagagctactatgcgctc
gacatccagatggacgaggcagccgagcgtctgggtctggacccggccgagctgaagctg
aaaaacgcggtgcgtgcgggcgacattgcgccctccggccacccgatcatcggccacggg
ctggagatgtgcatcaagcacggcgtcgatgtggtcgactggaaagcgctgcgcaatcgc
gaccgcacgccggacccgaagcgcccgcacatccgcaagggctggggcatcggttgcgag
atgcacgggtcgtctgcatacccgggcatcaaggaacagggcaatgccaccgtgaaggtc
aacgaggacgggaccgtgaccctcctgaccggcgctgcaggccttggcaccggtgcccat
accgcgctggcacagattgtcgcggaggaaattggcgtgcgcttcgaggatgtcggcatc
atccacggcgataccgacgtggtgccgtgggatatcggcgcgtttgccagtcacacgacc
tatctcgtcggcacagctgcgaagatggccgccagcaaggtccgcgccgccgttctggag
cgggcggcaatgaagctgcaggttttgcccgccgacgtcgatctcagtgaaggtaaggtc
ttcctgatcacggatcccaccagcgttatgacagtggccgaggcgatgggtccctcgcgc
ggcattcctgcagccaatatcgttgcaaacggtacctatgagccgaccaaatcctactcc
ttcgccgcgcatttcaccgaagtggacgtggatatcgatactggcatcgtcgaggtcaaa
cgtgtcgtgccggtgcatgacgtcggtcgcgtcatccaccctatcgccgcgcaaggtcag
atcgagggcggcatccagcagggtatcggccatacgctcaccgaggactacgtgatcgac
aagacgaccggccggtcccttaacgccggcctcgtcgactacaagatgccgctgtcgatg
gacatgccggagatcgagacggtcatcctcgaggcggcccctgatccgggcggcccgtgg
ggggcaaagggcgtcggcgaggacccgatcatcgcgatcggtccggccatcgccaacgcc
atccatgacgccatcggcgttcgcttccgccactatccgatcactccggaagacattctg
aaagccttgagggagaagggcgcatga

DBGET integrated database retrieval system