KEGG   Ensifer adhaerens OV14: OV14_b1263Help
Entry
OV14_b1263        CDS       T03054                                 

Definition
(GenBank) mannonate dehydratase related protein
  KO
K01686  mannonate dehydratase [EC:4.2.1.8]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00040  Pentose and glucuronate interconversions
ead01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OV14_b1263
Enzymes [BR:ead01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.8  mannonate dehydratase
     OV14_b1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UxuA AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AHK47458
UniProt: W8IRY5
Position
pOV14b:1330694..1331554
Genome map
AA seq 286 aa AA seqDB search
MLQPGERVCDYAPLKRMKDRYEEGGFALKVIEARPPLNKAKRGLPGRDEEIEVVLELLTN
MGKLGIPVWCYEWLADFSWLRTNFATPSRGGSLVTSFNIDHVPDDITSNPPISEEELWTN
LEYFLRKVLPAAEKAGVKMSMHPDDPPLSPIKGVGRIMRSVDNFQRLVDMLPSASNTITL
CQGNFTLMTDDLPSVIRKFGSKISFVHFRDVKGIATNFEETWHDDGKTDMLACMKAYKDI
GFDGVLRPDHVPTVEGDTNEDAGYSAFGRLYAIGYIRGLHEAVYRG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagcctggtgagcgcgtatgcgactacgcaccgctcaagcggatgaaggaccgc
tatgaagaaggcggctttgcgctcaaggttatcgaggcacgtccgccgctcaataaggcg
aagcgtgggctgcccggtcgcgacgaggaaatcgaggtcgtcctcgaactgctgaccaac
atgggcaagctcggcatcccggtttggtgctacgaatggctggccgacttcagctggctt
cgcaccaatttcgcaacacccagccgcggcggatcgctggtcaccagcttcaacattgac
catgtacctgacgacatcacgtccaaccctccgatcagcgaagaggaattgtggaccaat
ctcgagtatttcctgcgcaaggtgctgccggctgcggagaaggccggcgtcaagatgtcg
atgcatcccgacgatccaccgctgagcccgattaagggcgttggtcgtatcatgcgcagc
gtcgacaactttcagcgcctcgtcgacatgctgccgtcggcgtccaacaccataacgctg
tgccaaggcaacttcacgctcatgaccgacgacttgccgtccgtcatccggaagttcggt
agcaagatcagcttcgtgcatttccgcgacgtgaagggcatcgccacgaacttcgaggag
acctggcacgatgacggcaagacggacatgttggcgtgcatgaaagcgtacaaggacatc
ggcttcgacggtgtgctgcgaccggaccacgttccaacggtcgagggtgacacgaacgag
gatgccggctactccgccttcggccgcctctacgcgatcggatatatccgcggcctgcac
gaggctgtctatcggggctag

DBGET integrated database retrieval system