KEGG   Klebsiella aerogenes KCTC 2190: EAE_02050Help
Entry
EAE_02050         CDS       T01529                                 

Definition
(RefSeq) putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
KEGG Orthology (KO) [BR:eae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eae03009]
    EAE_02050
Enzymes [BR:eae01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     EAE_02050
Ribosome biogenesis [BR:eae03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EAE_02050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222 MIT_C Spt5-NGN
Motif
Other DBs
NCBI-GeneID: 10790578
NCBI-ProteinID: YP_004590624
UniProt: A0A0H3FLQ2
Position
complement(429358..430458)
Genome map
AA seq 366 aa AA seqDB search
MNKVVLYCRPGFEKECAAEITDKAARLEVFGFARVKDDSGYVIFECYQQGDGEKLVRDLP
FSSLIFARQMFVVGELLRDLPPEDRITPIVGMLQGVVEKGGDLRVEVADTNESKELMKFC
RKFTVPLRAALREAGVLTNYETPKRPVVHVFFIAPGCCYTGYSFSNNNSPFYMGIPRLKF
PSDAPSRSTLKLEEAFHVFIPADEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVSSVD
NGPMAQSLMDTGQVTWLREDGFRYRPNRNNISWMVCDMVEKPAKVAALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSQNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRLWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttgtcctctattgtcgccccgggtttgagaaagagtgcgcagcagaaatt
accgataaggcagcccgccttgaggtatttggttttgcccgggtcaaagacgactccgga
tatgtgatttttgagtgctatcagcagggcgatggcgagaagctggtgcgcgatctaccg
tttagctcgctgattttcgcgcgtcagatgttcgttgttggcgaactgctgcgcgacctg
ccgccggaagaccgcatcacgccgatcgtcggcatgctgcagggcgtggtggaaaagggc
ggtgatctgcgcgttgaggtcgcggataccaacgaaagcaaagagctgatgaagttctgc
cgcaagttcacggtgccgctgcgcgcggcgctgcgtgaagccggcgtgctgaccaactat
gaaacgccgaagcgtccggtggtgcacgtgttctttatcgcccccggctgctgttacacc
ggctactcctttagcaataacaactcgccgttttatatggggatcccgcgcctgaagttc
ccttccgatgcgccgagccgttcgacgctgaagctggaagaggcatttcacgtcttcatt
ccggcggatgagtgggacgagcgtctggcgaatggcatgtacgcggtggatctcggcgcc
tgcccgggcggctggacctatcagctggtgaagcgcaacatgtgggtctcttcggtcgat
aacggcccgatggcgcagagcctgatggataccggacaggtgacctggctgcgtgaagat
ggcttccgctatcgtccgaaccgcaacaacatctcgtggatggtgtgcgacatggttgag
aaaccggcgaaggtggcggcgttaatggcgcagtggctggtgaacggctggtgccgcgag
accatttttaaccttaagctgccgatgaaaaagcgctatgaagaggtgtcgcaaaacctg
gcctatattcaggcgcagcttgatgagcacggaattaacgcgcagattcaggcccgtcag
ttgtatcacgaccgtgaagaagtgaccgtacacgtgcgtcgcctgtgggcggcggtcggc
ggccgccgcgacgagcgctaa

DBGET integrated database retrieval system