KEGG   Klebsiella aerogenes KCTC 2190: EAE_02245Help
Entry
EAE_02245         CDS       T01529                                 

Definition
(RefSeq) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00071  Fatty acid degradation
eae00072  Synthesis and degradation of ketone bodies
eae00280  Valine, leucine and isoleucine degradation
eae00310  Lysine degradation
eae00362  Benzoate degradation
eae00380  Tryptophan metabolism
eae00620  Pyruvate metabolism
eae00630  Glyoxylate and dicarboxylate metabolism
eae00640  Propanoate metabolism
eae00650  Butanoate metabolism
eae00900  Terpenoid backbone biosynthesis
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
eae01200  Carbon metabolism
eae01212  Fatty acid metabolism
eae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAE_02245
   00630 Glyoxylate and dicarboxylate metabolism
    EAE_02245
   00640 Propanoate metabolism
    EAE_02245
   00650 Butanoate metabolism
    EAE_02245
  Lipid metabolism
   00071 Fatty acid degradation
    EAE_02245
   00072 Synthesis and degradation of ketone bodies
    EAE_02245
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EAE_02245
   00310 Lysine degradation
    EAE_02245
   00380 Tryptophan metabolism
    EAE_02245
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EAE_02245
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EAE_02245
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EAE_02245
Enzymes [BR:eae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EAE_02245
Exosome [BR:eae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAE_02245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 10790620
NCBI-ProteinID: YP_004590663
UniProt: A0A0H3FKQ6
Position
complement(480230..481408)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGTLARHSAVELGSVVVKALVERSGIDPQCIDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAWAL
SSQQKARRAIDSGRFRDEIVPVATEHNGSQRLVDTDEQPRMDASAEGLASLMPTFDQLGS
VTAGNASSINDGAAAVMMMSESKAQELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWQLDEVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtgatcgtcggcgcgttgcgtacgcctatcggctgttttcagggaacg
ctggcgcgtcactcggcggtggaattgggcagcgtggtggtgaaggcgttagtcgagcgg
agcggaatcgatccgcagtgcattgatgaagtgatcctcggtcaggtgctgaccgcgggc
accgggcagaatccggcgcgtcagtcggcgatccgcggcgggctgccgaataccgtttcg
gcgatcaccatcaacgacgtttgcggctccgggctgaaagcgctgcacctggcgactcag
gccatccaatgcggcgaagcggatgtagtgatcgccggcggccaggaaaacatgagccgc
gcgccgcatgtacttaccgacagccgaaccggcgcgcagctgggcaatagccagcttatc
gacagcctggtgcatgatgggctgtgggacgctttcaatgactaccatatgggcgtaacg
gcggaaaatctggcgcgggagtatgggatcagccgtgaactacaggacgcctgggcgctt
agctcgcagcaaaaagcgcggcgggcgatagactccgggcggtttcgcgatgaaatcgtg
ccggtcgccaccgagcataacggcagtcaacggctggtggataccgacgagcagccgcgg
atggatgccagcgctgaagggttagccagcctgatgcccaccttcgaccagcttgggtcg
gtgaccgcgggtaatgcatcgagtattaacgatggcgcggcggcggtaatgatgatgagc
gaatcaaaggcccaggagctggggctgccgattctggcgcgcattcgcgccttcgccagc
gtcggcgtcgatccggcgctaatgggtatcgcgccggtacatgccacccggcgctgcctt
gagcgcgcgggctggcagctggatgaggttgacttaatcgaagctaatgaagcttttgcc
gcccaggctatctccgttggcagagtgctggagtgggatgaacggcgggttaacgttaac
ggcggggctatcgccctgggccatccgattggcgcgtccggctgccgtattctggtgtcg
ctggtacatgaaatgatcaagcgcgatgcgcgtaaagggctcgcgacgctgtgtatcggc
ggcggtcagggcgttgcgctggcggtggagcgcgcataa

DBGET integrated database retrieval system