KEGG   Klebsiella aerogenes KCTC 2190: EAE_03695Help
Entry
EAE_03695         CDS       T01529                                 

Definition
(RefSeq) G/U mismatch-specific DNA glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:eae00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EAE_03695
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eae03400]
    EAE_03695
Enzymes [BR:eae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     EAE_03695
DNA repair and recombination proteins [BR:eae03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EAE_03695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 10790910
NCBI-ProteinID: YP_004590951
UniProt: A0A0H3FK15
Position
complement(774295..774801)
Genome map
AA seq 168 aa AA seqDB search
MISDVLAPGLRVVFCGINPGKSSAHTGFHFAHPGNRFWKVIHQAGFTERQLMPEEEQHLL
DTGCGITMLVERPTVQASEVALLELRNGAQELISKIQDYQPQALAVLGKQAYEQAFRVRG
AKWGKQEATIGETEIWVLPNPSGLNRATLDKLVEAYRELDEALAGRGR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgattagtgatgtcctggcgccggggctgcgggtggtcttttgcgggatcaatccgggg
aagtcctccgcgcatacggggttccattttgcccatcccggcaatcgtttctggaaggtc
attcaccaggcggggttcaccgagcgacagctgatgccggaagaggagcagcatctactg
gataccggctgcggtatcaccatgctggttgagcggccgacggtacaggccagcgaggtt
gccctgctggagctgcgtaatggcgcgcaggagctaataagcaaaatccaggactatcag
ccgcaggcgctggcggtgctcggcaagcaggcctatgagcaggcgttcagggtgcgtggc
gcaaagtggggaaagcaggaagcgaccatcggtgaaaccgaaatctgggtgctgcccaat
cccagcggtttgaaccgggcgacgctggacaagctggttgaagcctatcgcgaactggat
gaggcgctggcggggcgagggcggtga

DBGET integrated database retrieval system