KEGG   Klebsiella aerogenes KCTC 2190: EAE_06205Help
Entry
EAE_06205         CDS       T01529                                 

Definition
(RefSeq) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00051  Fructose and mannose metabolism
eae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EAE_06205
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     EAE_06205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 10791412
NCBI-ProteinID: YP_004591444
UniProt: A0A0H3FL48
Position
1290464..1291612
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGISLTFADVNQVVLDALNARHSYQVHVVGENEQVDTV
SGVNAVSSIGDEVVDLIADVDLVTTAVGPVVLERIAPAIAKGLVKRKAQGIERPLNIIAC
ENMVRGTSQLKGHVFNALAEEDKAWVEAHIGFVDSAVDRIVPPSASATHDPLEVTVETFS
EWIVDKTQFKGELPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEHIRAVVKGAMEESGAVLIKRYSFDAQKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHRNLVKGIAAAMHFRSEDDPQAQELAALIAEKGPQAALAQ
ISGLDAASAVVAEAVNDYNAVK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggacgtggcttcattggcaaactgctg
gctgacgccggtatctcccttacgttcgccgatgttaatcaggtggtccttgatgccctg
aatgcccgtcatagctatcaggtccacgtggtgggtgaaaacgaacaggttgataccgtc
tccggcgtgaatgccgtcagcagcattggcgatgaggtggtggatctgatcgccgatgtc
gacctggtgaccaccgcggtcggccccgtcgttctggagcgtatcgcccctgccatcgcc
aaaggcctggtgaaacgtaaagcgcagggtattgaacgcccgctgaatatcatcgcctgc
gaaaacatggtacgcggcaccagccagctgaaaggccatgtgtttaacgcgctggcggaa
gaggacaaagcgtgggttgaagcgcatatcggcttcgtcgactccgccgtagaccgcatc
gtgccgccgtcggcttccgccacccacgatccgctggaagtcaccgttgaaaccttcagc
gaatggattgtggataaaacccagtttaagggcgagctgccgaacatcccaggaatggaa
ttaaccgataacctgatggcatttgtcgagcgtaagctattcaccttaaacaccgggcat
gctataaccgcctacctcgggaaactggcgggccatcaaacgattcgcgacgcgattctc
gatgagcacattcgcgccgtcgtgaaaggcgcaatggaagagagcggcgcggtgctgatt
aaacgctacagctttgatgcgcagaaacacgcggcttatatccagaagatcctcggtcgc
tttgagaacccgtatctgaaagatgatgtggagcgcgtcggccgccagccgctgcgtaaa
ttgagcgcgggcgatcgtttgatcaagccgctgcttggcacgctggaatacggcctgccg
caccggaacctggtaaaagggattgccgcggccatgcatttccgcagcgaagacgatccg
caggctcaggaactggcggcgctgattgccgaaaaagggccacaggccgcgctggcgcag
atttccggtctggatgcggcaagcgctgtagtggcggaagccgttaacgactacaacgcg
gtaaaatga

DBGET integrated database retrieval system