KEGG   Klebsiella aerogenes KCTC 2190: EAE_06395Help
Entry
EAE_06395         CDS       T01529                                 

Definition
(RefSeq) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00770  Pantothenate and CoA biosynthesis
eae01100  Metabolic pathways
Module
eae_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:eae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    EAE_06395
Enzymes [BR:eae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     EAE_06395
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     EAE_06395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PALP
Motif
Other DBs
NCBI-GeneID: 10791450
NCBI-ProteinID: YP_004591482
UniProt: A0A0H3FLD6
Position
1325962..1327173
Genome map
AA seq 403 aa AA seqDB search
MSLAGKKIVLGVSGGIAAYKTPELVRRLRERGADVRVAMTEAAKAFITPLSLQAVSGYPV
SDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARVAAGMANDLVSTICLATPSPVVV
VPAMNQQMYRAAATQDNLATIAARGLLVWGPDSGSQACGDVGPGRMLDPLTIVEMAAQHF
SPVKDLQHLNIMITAGPTREPLDPVRYITNHSSGKMGFAIAAAAAQRGANVTLVSGPVSL
PTPPFVQRIDVGTALEMEAAVQNGVQQQHIFIGCAAVADYRAAIVADEKIKKQGDELTIK
MVKNPDIVAGVAALKNHRPYVVGFAAETNNVEEYARQKRARKNLDLICANDVSQPNQGFN
SDNNALHLFWQDGDKRLPLERKEFLGQLLLDEIVTRYDEKNRR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagtctggctggtaaaaagatcgttctcggcgtgagcggcggcatcgccgcctataaa
acgccagaactggtgcgccgactgcgagaacgcggcgccgatgtacgcgtcgccatgacc
gaagccgccaaggcctttattaccccgttgagcctgcaggcggtttccggttacccggtc
tccgatagcctgctggatccggctgccgaagcggcaatgggccatattgaactgggcaag
tgggccgatctggttatccttgccccggcaaccgccgatttaatcgcccgcgtcgccgcc
ggtatggcgaacgatctggtctccacgatttgcctggctacgccctctccggtggtcgtc
gttccggcgatgaaccaacagatgtatcgcgccgccgccacccaagacaaccttgccact
attgccgcccgcggcctgttggtatggggccccgatagcggcagccaggcctgcggcgac
gttggcccgggccgcatgctcgatccgctgactatcgtggagatggcggcgcagcatttc
tcgcctgtcaaagatttgcaacatctcaacatcatgattaccgcgggcccaacccgcgag
ccgctggacccagtgcgctacatcaccaaccatagctccggcaaaatgggcttcgcgatt
gccgccgccgccgcacaacgcggtgcgaacgtcacgctggttagcggcccggtgtcgctg
ccgacgccgccgtttgtgcagcgcatcgatgttggcaccgcgctggaaatggaagcggcg
gtgcagaatggcgtgcaacagcagcatattttcatcggctgcgccgccgttgccgactac
cgcgcagcgattgtcgccgacgagaaaatcaaaaaacaaggtgatgaattaacaataaaa
atggtcaaaaacccggacatcgtcgccggggtggccgcactaaaaaatcaccgcccgtac
gttgttggatttgccgccgaaacaaataatgtggaagaatacgcccggcaaaaacgtgcc
cgcaaaaatctcgacctgatttgcgccaatgatgtttctcagccaaatcaaggttttaat
agcgataacaacgcattacaccttttctggcaggatggggataagcgcttaccacttgag
cgcaaggaattcctgggccaattattactcgacgagatcgttacccgttatgatgaaaaa
aatcgacgttaa

DBGET integrated database retrieval system