KEGG   Klebsiella aerogenes KCTC 2190: EAE_12320Help
Entry
EAE_12320         CDS       T01529                                 

Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00860  Porphyrin and chlorophyll metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
Module
eae_M00121  Heme biosynthesis, glutamate => heme
eae_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EAE_12320
Enzymes [BR:eae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     EAE_12320
Exosome [BR:eae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAE_12320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-GeneID: 10792674
NCBI-ProteinID: YP_004592657
UniProt: A0A0H3FRU3
Position
complement(2644850..2645824)
Genome map
AA seq 324 aa AA seqDB search
MTDLITRPRRLRQSASLRAMFEETTLSLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDATGSDTWNENGLVARMTRIAKQAVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRRSLD
AAGFTNTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMSPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRERTDLPLGAYQVSGEYAMIKFAAQAGAIDEEKVVLESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttaatcactcgcccacgccgcctgcgtcaatccgcctcgctgcgcgccatg
tttgaagagacaacactgagtttgaacgacctggtgttgccgatctttgttgaagaagaa
attgacgattacaaagccatcgaagcgatgcctggcgtcatgcgtattccggaaaaacat
ctggcgcgcgaaattgagcgcatcgccaacgccggtattcgttcagtgatgacttttggc
atctcccatcataccgacgcgaccggtagcgatacctggaacgaaaacggtctggtggcg
cggatgacccgtatcgccaaacaggcggtgccggaaatgatcgtcatgtccgatacctgc
ttctgcgaatacacctcgcacggccactgcggcgtgctgtgcgagcacggcgtcgataac
gatgcgactctggaaaatctcggtaagcaggcggtggtcgccgcggccgccggcgctgat
ttcatcgcgccctccgccgcgatggacggtcaggtgcaagcgatccgccgttcgctggat
gccgcgggctttactaataccgcgattatgtcttactcgaccaaattcgcgtcatcgttc
tacggcccgttccgtgaagccgccggtaccgcgctgaaaggcgatcgtaagacctaccag
atgagcccgatgaaccgtcgcgaagcaattcgcgagtcgctgctcgatgaagcccagggc
gcggactgcctgatggtgaaaccggccggtgcctatctggatatcctgcgtgatatccgc
gagcgcaccgacctgccgctcggcgcttatcaggtcagcggcgagtacgcgatgatcaaa
tttgccgcgcaggctggcgcaatcgacgaagagaaagtggtgctggaaagccttggcgca
attaaacgcgcgggcgcggacctgatcttcagctatttcgccctcgatctggccgagaaa
aaaatcctgcgttaa

DBGET integrated database retrieval system