KEGG   Klebsiella aerogenes KCTC 2190: EAE_14285Help
Entry
EAE_14285         CDS       T01529                                 

Gene name
galM
Definition
(RefSeq) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00010  Glycolysis / Gluconeogenesis
eae00052  Galactose metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
Module
eae_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_14285 (galM)
   00052 Galactose metabolism
    EAE_14285 (galM)
Enzymes [BR:eae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EAE_14285 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 10793079
NCBI-ProteinID: YP_004593049
UniProt: A0A0H3FTT3
Position
complement(3071416..3072459)
Genome map
AA seq 347 aa AA seqDB search
MLTPTRELAPDGQPWNVITLRNDAGMSVTVMDWGATLLSAQVPLADGSLREALLGCATPQ
QYRQQAAFLGASVGRYANRIANSRFTLDGEVVNLTPSNEAGHQLHGGPDGFDKRRWQIVS
HDDSQVLFALDSADGDQGFPGHLQATARYRLTDDNRIAIEYRATVDKPCPVNMTNHVYFN
LDGAQGDVRHHRLQILADQYLPVESDGIPYGDLRDVEYTSFDFRAPKVLAGEFLADADQQ
KVKGYDHAFLLQAKGDARQPAAHVWSQDEKLQLTVYTSAPALQFYSGNYLGGTPSRGSQP
YGDWQGLALESEFLPDSPNHPHWPQPDCVLRPGAEYVSLTEYQFIAG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgccaactcgcgaactcgcgcccgacggacagccgtggaacgtgataacgctg
cgtaatgacgccgggatgagcgtaacggtgatggactggggcgcgacgctactttccgcg
caagtgcctcttgccgatggcagcctgcgcgaagcgttgcttggctgcgccacgccgcag
caatatcgccagcaggcggcatttctgggcgcatccgtcggccgctacgctaaccgtatc
gccaacagccgcttcacgctcgatggcgaagttgtgaacttaaccccgtcgaacgaggcc
ggccaccagctccacggcgggccggacggcttcgacaaacgtcgctggcaaattgtcagc
cacgacgacagccaggtgctgtttgcgctcgactccgccgatggcgatcagggcttcccg
ggtcatcttcaggcaaccgcgcgctatcgcctgactgacgataatcgtatcgccattgag
taccgcgccaccgttgataagccctgcccggtcaatatgactaaccatgtctattttaac
ctcgacggcgcgcagggcgacgtgcgccaccaccgcctgcagatcctggccgaccagtat
ctgccggtggagagcgacggtattccgtatggcgatttgcgcgacgtggagtacaccagc
tttgatttccgcgcgccgaaggtgcttgctggagagtttcttgccgatgctgaccagcaa
aaagtgaaaggttacgatcacgcctttctgctgcaggccaaaggcgacgcccgccagccg
gcggcgcatgtctggtcgcaggatgaaaagctacagctgacggtgtacacctcggccccg
gcgctgcagttttattccggtaactatctcggcggcacgccatcgcgcggcagtcaacct
tacggcgactggcaagggctggcgctggaaagcgagttcctgccggactcccccaatcat
ccgcattggccgcagccagattgcgtattacggcccggcgccgaatacgttagtctgacg
gaatatcagtttatcgccggataa

DBGET integrated database retrieval system