KEGG   Klebsiella aerogenes KCTC 2190: EAE_15490Help
Entry
EAE_15490         CDS       T01529                                 

Definition
(RefSeq) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00052  Galactose metabolism
eae00500  Starch and sucrose metabolism
eae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EAE_15490
   00500 Starch and sucrose metabolism
    EAE_15490
Enzymes [BR:eae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     EAE_15490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-GeneID: 10793319
NCBI-ProteinID: YP_004593288
UniProt: A0A0H3FTU2
Position
complement(3347733..3349133)
Genome map
AA seq 466 aa AA seqDB search
MSQPSLLPLVLQAVMNHQPRALRDKHYPQWHLAPVCGLLNDPNGFIHFNGRYHLFYQWNP
LACDHRYKGWGHWSSPDLLHWRHEPIALLPEEEYDRNGCYSGSAVDNNGILTLCYTGNVK
FNDGSRTAWQCLATQNPDGTFRKQGPVLALPAGYSGHVRDPKVWRDGDRWLMVLGARDLA
DRGKVLLFSSTDLMQWNSHGEIAGSGLNGLKDAGYMWECPDLFPLGDRYILLSCPQGLPR
EAQRFLNTYPAVWMQGHFDQTAATWRHGAIEELDSGFEFYAPQTTLAEDGRRLLVGWMGV
PDGEEMQQPTRAHGWIHQMTCLRELSWRHGTLYQNPVRELAALRGEAQGWQTEPLALQPM
ELAFEVAPDDALTLDFAGALQLSLDSRGVRLARRSLVADTVDYRYWRGAAHKLQILIDRS
SVEIFINDGVGVMSSRFFADYPGKLVFSGATPGAFCCWPLRPCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagccttctttgttaccgttggtcttgcaggccgtcatgaaccaccagccgcgc
gcgctgcgggataagcactatccgcagtggcatctggcgccggtatgcgggctactgaac
gatccgaacggttttatccacttcaatggtcgttatcatctgttttatcagtggaatccc
ctcgcctgcgatcaccgctataagggctggggacactggagttcgccggatctgctgcac
tggcggcacgaaccgattgccctgctgccagaggaggagtacgaccgtaacggttgttac
tccggcagcgcggtagataacaacggcatcctgacgctgtgctacaccggtaatgtgaaa
tttaacgatggcagccgtaccgcctggcagtgtctggcgacgcaaaatcccgacggcact
tttcgcaaacagggcccggtgctggcgctgccagcaggctatagcggccacgtgcgcgat
cccaaagtctggcgcgatggcgatcgctggttgatggtgctgggcgcgcgcgatctggcc
gaccgcggcaaggtactgctattcagctctactgatttgatgcagtggaatagccatggc
gaaattgccggtagcggacttaacggcttgaaagacgccggctatatgtgggaatgcccg
gatctgttcccgctcggcgatcggtatattttactgagctgcccgcagggattgccgcgt
gaggcacagcgcttcctgaacacctatccggcagtctggatgcagggccatttcgatcaa
accgccgccacctggcgccatggcgcgatcgaagagctggatagcggcttcgaattctat
gcgccgcaaaccaccctggcggaggatggtcgccgtctgctggttggctggatgggggtt
cccgacggagaagagatgcagcaacctacgcgggcccacggctggatccatcagatgacc
tgcctgcgggaactcagctggcgccacggcacgctgtatcaaaatcccgtgcgcgaactg
gcggcgcttcgcggcgaggcgcaaggctggcagaccgaaccgctggcgctgcagccgatg
gaactggccttcgaggttgcgccagacgatgcgctgacgctggatttcgcgggcgcgctg
cagctttcgctggacagccgcggcgtacgtctggcccgtcgaagcctggtggccgataca
gtcgattaccgttactggcgcggcgcggcgcataaactgcagatcctcatcgaccgttcc
agcgtcgaaatctttattaacgatggcgtgggagtgatgagcagccgcttctttgcggat
tatcctggaaaactggtattcagcggtgcgacgccgggggcattctgctgctggccgctg
cggccatgcatggtagaataa

DBGET integrated database retrieval system