KEGG   Klebsiella aerogenes KCTC 2190: EAE_18245Help
Entry
EAE_18245         CDS       T01529                                 

Definition
(RefSeq) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00020  Citrate cycle (TCA cycle)
eae00620  Pyruvate metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01200  Carbon metabolism
Module
eae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAE_18245
   00620 Pyruvate metabolism
    EAE_18245
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     EAE_18245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo K_oxygenase FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 10793873
NCBI-ProteinID: YP_004593835
UniProt: A0A0H3FVF5
Position
3935353..3937008
Genome map
AA seq 551 aa AA seqDB search
MPAIKKTIISMTALAMFVSTATYANGDTSKKTDFLLIGGGIMSASLGTWLQELQPEWKQV
MVEKLDGVALESSNGWNNAGTGHSANMELNYTPQRADGSIDVSKALDINEQFMISRQFWS
AQVKRGILHDPHSFINSTPHMSFVWGDNVDYLQKRYNALQQTTLFQGMKFSTDHAQIKQW
APLVMEGRDPQQKVAATWTPVGTDVNYGEITRQLIGSLKKSSNFSLQTSSEVTDFKRNAD
NSWHVTIKNVQSGEEQAIDAKYVFIGAGGGALKLLQKTGIPEADNYAGFPVGGSFLMTEN
PELTKLHQQKVYGQASVGAPPMSVPHLDARYLDGKRVVLFGPFATFSTKFLKNGSFFDLL
STTTTSNVLPMTHVGLDNFDLVKYLISQVMLNDDDRFAALKEYYPNARKEDWKLIQAGQR
VQIIKKDAEKGGVLKLGTEVVVDQQKTISALLGASPGASTAAPITLNVLKQMFPQQFNSP
EWQSRIRAIVPSYGEKLNGNVALTQQVWDDTAAALQLTKPPVIQMPETAPTATAKPAETP
REASPQHDMAL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaattaaaaaaacgattatatctatgaccgcattagcgatgttcgtcagtacg
gcgacctacgcaaatggcgatacctcgaaaaaaactgactttctgctgatcggcggcggc
atcatgagcgcctcgctgggcacctggctgcaggagttgcagccggagtggaaacaggtg
atggtggagaaactcgacggcgtcgcgctggagtcctccaacggctggaataacgccggt
accggtcactcggcgaatatggaactgaactacacgccgcagcgtgcagacggttctatt
gatgtcagcaaagcgctggatatcaacgaacagtttatgatttcgcgccagttctggtcg
gcgcaggtcaaacgcggtattttgcacgacccgcactcgtttattaattccacgccgcat
atgagtttcgtgtggggcgataatgtggattatctgcaaaagcgttataacgcgctgcag
cagaccaccttattccagggaatgaaattctccaccgatcacgcgcaaattaaacagtgg
gcgccgttggtgatggaaggacgcgatccgcagcaaaaagtggccgcgacctggacgccg
gtcggtaccgatgtgaactacggtgaaattacccgtcagctgatcggtagcctgaaaaag
agcagcaacttctcgctgcagacctcttctgaagtcaccgattttaaacgcaatgccgac
aactcctggcacgtgacgattaagaacgtgcagagcggtgaagagcaggctatcgacgcc
aaatatgtcttcatcggcgccggcggcggcgcgttgaagctgctgcagaaaaccggtatt
ccggaagcggacaactatgcgggcttcccggtaggcggctcattcctgatgaccgagaac
ccggagctgactaaactgcaccagcagaaagtttatggtcaggcttcagttggcgcgccg
ccgatgtcggtaccgcacctggatgctcgttacctcgatggtaagcgcgtggtgctgttc
gggccattcgccaccttctccaccaagttcctgaaaaacggctcgttcttcgatctgctg
agtaccaccaccaccagcaacgtactgccgatgacccacgttggcctcgacaacttcgat
ctggtgaagtacctgattagccaggttatgctcaacgatgatgaccgctttgcggcgctg
aaagagtactacccgaacgcgcgtaaagaagactggaaactgattcaggccggtcagcgc
gtgcagatcatcaaaaaagacgcggagaagggcggcgtgctgaagctcggtaccgaagtg
gtggtcgatcagcagaaaacgatttctgcgctgctcggcgcatcgccaggtgcttccacc
gccgcgccgatcaccctgaacgttctcaagcagatgttcccgcagcagtttaactcgccg
gaatggcagagccgcattcgcgctatcgtgccgagctacggcgagaagttaaacggcaac
gtggccctgacccagcaggtttgggatgacaccgccgcggcgctgcaactgaccaagcct
ccggtcattcagatgccagagacggcgccgaccgcgaccgccaaaccggcagagacgccg
cgcgaggcctcgccgcagcacgatatggcgctgtaa

DBGET integrated database retrieval system