KEGG   Klebsiella aerogenes KCTC 2190: EAE_19410Help
Entry
EAE_19410         CDS       T01529                                 

Definition
(RefSeq) type VI secretion system protein ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
KEGG Orthology (KO) [BR:eae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eae02044]
    EAE_19410
Secretion system [BR:eae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAE_19410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-GeneID: 10794106
NCBI-ProteinID: YP_004594068
UniProt: A0A0H3G0X7
Position
complement(4158895..4159419)
Genome map
AA seq 174 aa AA seqDB search
MAISKSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVDNQPAVDER
KFLDIDIDNFDERMKALKPRVAFQVDNTLTNEGKLNVDLTFDSMDDFLPDAVARKVEPLN
KLLEARTQLSNLLTYMDGKNGAEELIAKILQDPTLLKSLSQMPKQDDSAKGSEE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcaataagtaaaagtgggcagaaatttatcgcacgcaaccgtgcgccccgcgtacag
atcgagtacgacgtagagatttatggtgcggaacgcaaaatccagcttccgtttgtaatg
ggggtaatggcggatctggtgggtaaaccggtcgacaaccaacccgcggtcgatgaacgt
aagtttctcgacatcgatattgataacttcgacgaacgtatgaaagcgctgaaaccgcgc
gtcgctttccaggtcgacaatacgctgaccaacgaaggcaaactgaacgtcgacttaacc
ttcgacagcatggacgacttcctgccggatgccgtggcccgcaaagtggagccgctgaac
aaactgctggaagcccgcacccagctttcaaatctgctcacctacatggacggcaaaaac
ggcgcggaagagctgattgccaaaattttgcaggatccgacgctgctcaaatcgttgagc
cagatgccgaaacaagatgacagtgcgaaaggtagcgaggagtaa

DBGET integrated database retrieval system