KEGG   Klebsiella aerogenes KCTC 2190: EAE_19760Help
Entry
EAE_19760         CDS       T01529                                 

Definition
(RefSeq) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00010  Glycolysis / Gluconeogenesis
eae00071  Fatty acid degradation
eae00350  Tyrosine metabolism
eae00625  Chloroalkane and chloroalkene degradation
eae00626  Naphthalene degradation
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
eae01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_19760
  Lipid metabolism
   00071 Fatty acid degradation
    EAE_19760
  Amino acid metabolism
   00350 Tyrosine metabolism
    EAE_19760
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EAE_19760
   00626 Naphthalene degradation
    EAE_19760
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EAE_19760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 CoA_binding 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 10794176
NCBI-ProteinID: YP_004594138
UniProt: A0A0H3G125
Position
4237286..4238296
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTHDHQIDVTDKKLRPLEHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGIVEKVGPGVTSLKPGDRASVAWFFEGCGHCEYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVTADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAVDVNDGQLELAASMGADLTVNSRNEDAAKIIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLIEAFQFAAEG
KVVPKVTLRPLGDINAIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtagtcacccacgaccaccagattgatgtaaccgataaaaagttacgc
ccgctggagcatggcgaagcgctgctgaaaatggaatgctgcggggtctgccacactgac
ctgcacgtgaaaaacggcgatttcggcgataaaaccggcgtcattctcggccatgagggc
atcggcatcgtggaaaaagtcggccctggcgtgacgtcgctgaagccgggcgatcgcgcc
agtgtggcgtggttctttgaaggttgcggccactgcgaatactgtaacagcggcaacgaa
accctgtgccgctcggtgaaaaatgccggttataccgtcgatggcgggatggccgaagag
tgtatcgtcaccgccgattacgcggtcaaagtgccggatggactggattccgccgccgcc
agcagcatcacctgcgccggcgtcaccacctataaagcggtgaaggtctcacacatcaag
cccggccagtggattgccatttatggcctcggcggcctgggtaacctggcgctgcaatat
gccaaaaacgtctttaatgccaaagtgatcgccgttgacgtcaacgacgggcagctggag
cttgccgcctcgatgggcgccgacctgacggtaaattcccgcaacgaagacgccgccaaa
atcattcaggagaaaaccggcggcgcccacgcggccgtggttaccgccgttgctaaagcg
gcatttaactctgccgtggatgcggttcgcgccggcggccgcgtcgtcgccgttggccta
ccgccggaagccatgagcctcgatattcctcgtctggtgctggacgggattgaagtagta
ggttcgctggtaggtacccgtcaggatctgattgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcactctgcgcccgctcggcgatatcaacgccatctttaaggag
atggaacagggtcaaatccgcggccgtatggttatcgatttccgccgttaa

DBGET integrated database retrieval system