KEGG   Klebsiella aerogenes KCTC 2190: EAE_20735
Entry
EAE_20735         CDS       T01529                                 

Definition
(RefSeq) type VI secretion system protein ImpG
Organism
eae  Klebsiella aerogenes KCTC 2190
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-GeneID: 10794369
NCBI-ProteinID: YP_004594331
UniProt: A0A0H3FXD8
Position
complement(4442155..4442469)
AA seq 104 aa
MLDLDKAGTPDPYVERLFEGVAFSMERLREKIDDDLPELTEGLVSMLWPHYLRTIPWLSV
VALTPELPTMKMAETVPAGLEIYSRPLGPKNTVCCAACAERGAA
NT seq 315 nt   +upstreamnt  +downstreamnt
atgctggatctcgacaaagccggtacgccggatccctacgtagagcgtctgtttgaaggg
gttgctttttccatggagcgcttgcgggaaaagattgatgacgacctgcctgagcttacc
gaagggctggttagcatgctgtggccgcactatctgcgcaccattccgtggctatcggtg
gtggcgctgacgccggaactaccgacgatgaagatggcggaaacggtgcctgccgggctg
gagatatattcccgcccgctggggccgaaaaataccgtctgctgcgccgcctgcgcagag
cgtggggccgcgtga

DBGET integrated database retrieval system