KEGG   Klebsiella aerogenes KCTC 2190: EAE_20740
Entry
EAE_20740         CDS       T01529                                 

Definition
(RefSeq) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
KEGG Orthology (KO) [BR:eae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eae02044]
    EAE_20740
Secretion system [BR:eae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAE_20740
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-GeneID: 10794370
NCBI-ProteinID: YP_004594332
UniProt: A0A0H3FTH9
Position
complement(4442539..4444113)
AA seq 524 aa
MASVHTLISASQVAPEALAAQTQQRLLLWENWLQPVTAEQPTGDDPGYDDDFQLMREEVN
KLSGANTDLICQLAEKLLTTVTQDIRVASYYAWARLHRDGEAGLADGLELLAGLMQRFGV
SLHPQRDRSRRAALDWLASQRMLDSLSLYPEVCNSDALRITGALLIMEQTQEGAVPGALC
AALETRLMKSGGPEAVVPQNISDAPLAAVGGSAPVLSGITSGQELLTQARVLAKYLSDQP
DGWLSAHHLIKSIRHDTLHQLPPLLAGGRTRIDPPKPDQRALLKRLYLQQSWMELLEQAS
EMFSRGANHLWLDLQWYVHQALLKSGRDAQAAIIQHDLQGLLARLIGLEGLAFNDGTPFA
DEVTLNWIQQQVLDNATIWLDDTASRAVTASGDDNILQLEPEALALVDSDGAEAALTWLQ
HRPGITTPRSRWLLRLLMARIAEQSGKNELAQHLLAELDVLAATLSLAQWEPELLFEVRA
RHLRLLRGKAGRSETERARLQSQMDRLLADLIAIDPARAAVLCV
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggcatcagttcatacattgattagtgcgagccaggtagcgccggaagcgctggccgca
cagacccagcagcgtttgctgctgtgggaaaactggctgcagccggtcacggccgagcaa
ccaacgggcgatgatcccggctatgacgatgatttccagttgatgcgcgaagaagtgaat
aagctatccggcgccaataccgatctgatttgtcagcttgcggaaaagctgctgaccacc
gtcactcaggatatccgcgtcgcctcatactacgcctgggcccgcctgcaccgcgatggc
gaagcgggtctggctgatgggctggaattactggctggattaatgcagcgttttggcgtg
agtctacacccgcagcgggatcgcagcaggagagctgcccttgactggctggcgagccag
cgcatgctcgacagcctgtcgttatacccggaggtatgcaacagcgatgcgctacgtatc
accggcgcgttgctgatcatggagcagacgcaagaaggggcggtccccggcgcgttgtgc
gccgccctcgaaacccggttaatgaaatccggcgggccagaagctgtggtcccgcagaat
atcagcgatgcgccgctagcggcggtggggggcagcgcgccagtgctcagcggtatcacc
tctggtcaggagctgctgacgcaggcgcgggtgctggcaaagtatctcagcgaccagccg
gatggctggctctctgcccatcacctgataaagagcattcgccatgatacgctgcatcag
ttgccgccgttactggcgggcggcagaactcgtattgatccgccaaaaccggaccagcgg
gcgctgctgaaaaggctgtatctccaacagagctggatggaattactcgagcaggccagc
gagatgttttcccgcggcgcaaaccatctgtggctggatctgcagtggtatgttcaccag
gcgctgttgaaatccgggcgcgacgcgcaggccgctattattcagcatgatctgcaagga
ctgctggcacgtttgatcggcctggaagggttggcgtttaacgatggtacgccgtttgcc
gatgaggtgacgctgaactggatacagcaacaggtgctggataatgcaaccatctggctg
gacgacaccgcttcccgcgccgtcaccgcttccggcgacgacaacatccttcagttagag
ccggaggcgctggctctggtcgacagcgatggcgctgaggcggcgctgacctggctgcaa
catcgtccgggtatcaccacccccagaagccgctggttactgcgattattgatggcgcgg
attgccgagcagagcgggaaaaacgaactggcgcaacatctgctggcggaactggacgtg
ctggcagccacgctgtcactggcgcaatgggaaccggaactactgtttgaagtccgagcg
cgtcatctgcggctgttgcgcggtaaggccggacgcagcgaaacggaaagagctcgtctg
cagtcgcagatggaccgtttgctggcggacctgattgctattgaccccgcccgcgcggcg
gtgctgtgcgtttaa

DBGET integrated database retrieval system