KEGG   Klebsiella aerogenes KCTC 2190: EAE_20755
Entry
EAE_20755         CDS       T01529                                 

Definition
(RefSeq) type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EAE_20755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eae02044]
    EAE_20755
Secretion system [BR:eae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAE_20755
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 10794373
NCBI-ProteinID: YP_004594335
UniProt: A0A0H3FWU7
Position
complement(4447373..4447864)
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPLMHD
IKNPAYEKHSHLEQIELRYEKITWTYKDGNIIHSDSWNERTTA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaataccagtctatttgtggttgaaagacgacggcggggcggacattaaaggttcc
gtggatgtgaaagatcgggaaggcagcatcgaagtggtggcgcaggagcataacctgtac
atcccgaccgacaacaacaccggaaagctaaccggcacgcgtatccacacgccgtttctg
tttaccaaggaaatcgactcctcaagcccctatctctacaaggcggtgactaccggccag
acgctgaagtctgccgaattcaagtggtacaaaatcaatgatgctggtcaggaagtggaa
tacttcaacacaaaactggaaaacgtgaaagtggtgaaggtcaatccgctgatgcacgac
atcaagaacccagcctacgagaagcacagccatcttgagcagattgaactgcgctacgaa
aaaatcacctggacctataaagacggcaacatcattcattccgattcatggaatgaacga
acgacagcctga

DBGET integrated database retrieval system