KEGG   Klebsiella aerogenes KCTC 2190: EAE_21920Help
Entry
EAE_21920         CDS       T01529                                 

Definition
(RefSeq) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EAE_21920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eae02044]
    EAE_21920
Secretion system [BR:eae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAE_21920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C DNA_pol3_gamma3
Motif
Other DBs
NCBI-GeneID: 10794602
NCBI-ProteinID: YP_004594564
UniProt: A0A0H3FU04
Position
complement(4688789..4692172)
Genome map
AA seq 1127 aa AA seqDB search
MFKEKNAAVMTVAATATLCLAVWTTVVLLSGLGWWNWHANRTLQWTAIREIVTVCGLIWA
YGLCLWILGFIAFHLFIRQKADGQQRQTQTFISQQTKPAQPFASLKHFLRRRYGRLWRNK
VRLLWVAGEAAQIAAIAPGLAQQQWLEGRGTVLIHGGSLSATVDIERLSALRRLRGRRPL
DGIVLALDNAQATAATLDGYLRTLEQVAQVLRYQPPVYLWQLHDSDWPQDTRITQTLGAL
FPPRAVPQDVERQLRAILPAMLAQGTQQLCADSSHDYLLRVAKWLKEGGISGWKTLLTPW
LTGHLQQIPLRGLLFSPSLKAEEAVDNGLYPHRWPAPAVWQGIIADCGRARGVPVGVAWR
PSLGVGLLALIALWAAGSLLSFIVNRQQIVSATQRVQLLRQPVVNDQQLIDLQVLRNDIG
RLQNQLANGTPWYQRFGLNHNAPLSAALLPWYGRANQRLIRDAAAQALTRQLTVLVNLPP
RSPQRAQLAKAGYDQLKAYLMMARPDKADAAFYRQAMTAAQQTCQGVAPALWQSIAPDLW
GFYMDNLPSQPTWRITPDAVLVTQARQVLLAQIGRRNAESTLYENMLLQVRRNYADMTLE
DMTPQTNASRLFTTEEVVPGMFTRQAWEGGVREAIDKAVATRRDEIDWVLSDSRQTVSGD
VSPEALKQRLTDRYFTDFAGAWLGFLNSIRLNPARNIADVTDQLTLAGDVRQSPLIALMN
TLAWQGQTGQQREGVADSLVKSAKNLLDKDKQPFIDQQAGGARGPLESTFGPLLALMGKN
PSQSVVAADSTLSLQTWLTRLTRVRLRLQQVANAPDPQAMMQQLAQTVFQGKSVDLTDTQ
EYGSLVAASLGEEWSGFGQTMFVQPLTQAWETVLQPSAASLNEAWQRSVVANWHSAFDGR
YPFAAGKNDVSLPMLAAFIRRDSGRIDQFLARQLGGVLNREGSRWVADSAHSQGLTFNPA
FLKAINQLSSLSDILFTDGSQGMGFELQGVATPGIVETQLTLDGQNLHYFNQLAEWKSFR
WPGTINKPGAMLSWSSVAAGARLLANDSGPWGTLRMLERMKRQQIGDGLFRLTVNTPDNR
QLQWLLRTELGDGPLALLKLRNFTLPTQIFIVEASQAEPFADGDVEE
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaggaaaaaaatgccgcggtaatgaccgtagcggctaccgcgaccctgtgtctt
gccgtctggacaactgtggtcctgctgagcggtctgggatggtggaactggcacgccaac
cgcacgctgcagtggacggcgatccgcgagatagtgaccgtctgtggcctgatttgggcg
tatggtctctgtctctggatactgggctttattgctttccacctgtttatcaggcaaaaa
gccgatgggcaacagcgtcagacgcagacttttattagccagcagacaaaaccggcgcag
ccgtttgcgtccttaaagcactttctccgtcgccgctacggccgattgtggcgcaataag
gtccgcctgctgtgggtcgctggcgaggcggcgcagattgccgccatcgctccaggcctt
gcgcaacagcaatggctggagggccgcggtacggtgctaattcacggcggtagcctgtcg
gcgacggtggatatcgagcggctcagcgccctgcgtcggctgcgcggccgccggccgctg
gatggtatcgtgctggcgctggacaatgctcaggccaccgccgcgaccctggacgggtat
ttgcgaacgctggagcaggttgcgcaggttctgcgctaccagccgccggtctatctgtgg
caactccacgacagcgactggccgcaggatacgcgcattacccagacgctgggggcgttg
ttcccgccgcgggccgtcccgcaggatgttgaacggcagcttcgcgccattctgcccgcc
atgctggcgcaggggacccagcagttgtgcgctgattcgtcccacgattacctgctgcgt
gtcgctaaatggctgaaggagggtggtatcagcggctggaagacgctactgacgccgtgg
cttaccgggcatctgcaacagatcccgctccgtggtctgctgttcagcccctcgttaaag
gcggaagaagcggtggacaatgggctctatccccaccgttggccggccccggccgtctgg
caggggatcatcgcagactgcggccgcgcgcgcggcgtgccggtgggggtggcgtggcgc
ccctccctcggcgtcggcctgctggcgctgattgctctgtgggcggcgggaagcctgctc
tcttttatcgtcaaccgccagcaaattgtcagcgccacccagcgggtacagctgctgcgg
cagcccgtcgttaacgaccagcagctgatcgatttgcaggtgctgcgcaacgatatcggc
cgtctacagaatcagctcgccaacggcacgccctggtatcagcgctttggtcttaatcat
aatgcgccgctttctgccgcgctgctgccgtggtatgggcgggctaaccagcgcctgatc
cgcgacgccgcggcgcaggcgctgacccggcaactgacggtgttggtcaacctgccgccg
cgcagcccgcagcgggcgcagctggcgaaagcgggttatgaccagttaaaggcctatctg
atgatggcgcgtccggacaaagccgatgcggcgttttaccgccaggcaatgaccgcggcg
cagcagacgtgtcagggagtcgccccggcgctatggcagagcatcgcccccgatttatgg
ggcttctatatggacaacttgccgtcgcagccgacgtggagaatcaccccggacgccgtg
ctggtgacgcaagcgcgtcaggtgctgctggcgcaaatcgggcggcgcaacgccgaaagc
acactttacgagaacatgctgctgcaggtgcgccgtaactatgccgacatgacgctggaa
gacatgacgccgcagaccaatgccagccggttgtttaccacggaagaggtggtgccgggg
atgtttacccgtcaggcgtgggagggcggcgtgcgcgaggcgatcgataaggcggtggcg
accaggcgcgatgagatcgactgggtgctgagcgatagccgccagaccgtcagcggcgac
gtctccccggaggcgttgaaacagcggctgaccgatcgttatttcaccgatttcgccggg
gcgtggttgggttttctcaatagcatccgcttgaatccggcgcgcaatattgccgatgtg
accgatcagttgacgttggcgggcgacgttcgtcagtcgccgctgattgcgttgatgaat
acccttgcctggcaggggcagaccgggcagcagcgtgagggcgtggcggattcgctggtg
aaatcggcaaaaaatctactcgataaggataagcagccgtttatcgaccagcaggccggc
ggcgcgcgcggcccgctggagagtacctttgggccgctgctggcgctgatgggcaaaaat
ccctctcaaagcgtggtcgccgcagacagcaccctcagtttacagacctggctgacgcgc
ctgacccgcgtacgcctgcggctccagcaggtggcaaacgcccccgacccgcaggcgatg
atgcagcagctggcgcagaccgtgttccagggtaaaagcgtcgacctgaccgacacccag
gagtacggcagcctggtggcggccagcctcggcgaagagtggagcggtttcggccagacc
atgttcgtccagccgctgacgcaggcctgggaaacggtgctgcagccatcggctgccagc
ctgaacgaggcgtggcagcgttctgtggtcgctaactggcattcggctttcgacggccgc
tatccgtttgccgcgggcaaaaacgatgtctcgctaccgatgctggcggcattcatccgt
cgcgatagcgggcgaatcgaccagtttcttgcccgacagttgggcggcgtgctcaaccgg
gagggtagccgctgggtggccgatagcgcgcacagtcaggggctgactttcaatccggcc
ttcctgaaggcgattaatcaactgagttccttgtccgacatcctgtttaccgacggcagt
cagggaatggggtttgaactacagggggtggcgacgccgggcattgttgaaacgcaactc
accctcgacggccagaatctgcactactttaaccagcttgccgaatggaaaagtttccgc
tggccggggactatcaacaaacccggcgcgatgctgagctggagctcagtggcggcgggc
gctcggctattggcgaacgacagcggcccgtggggcacgctgcgtatgctggagagaatg
aagcgccagcagatcggcgatgggctgtttcgtctgacggtcaatacgccggataaccgg
caactgcagtggctgctgcgtaccgaactcggcgatggcccgctggcgttgctgaaactg
cgaaacttcacgttgccgacacagattttcatcgtggaggcctcccaagcagaaccgttt
gccgacggtgacgtagaggaataa

DBGET integrated database retrieval system