KEGG   Klebsiella aerogenes KCTC 2190: EAE_21985
Entry
EAE_21985         CDS       T01529                                 

Definition
(RefSeq) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EAE_21985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eae02044]
    EAE_21985
Secretion system [BR:eae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAE_21985
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1
Other DBs
NCBI-GeneID: 10794613
NCBI-ProteinID: YP_004594575
UniProt: A0A0H3FXN4
Position
complement(4703731..4706109)
AA seq 792 aa
MSDIKPLLFNHSHHLLQVHGCNSLLDVLCFEGEENLSEPFRYTIEFTSSDKAITPQQMLL
QNASLTLQAPVDQGFGIKIQQPVRVLQGVITSFERLSIAKEETRYALTLQPRLALLSKSH
QNRIYQDMSAPQIVEHILRTRHQMRGEDFVFQLAHEYPQREQVMQYGEDDLTFISRLLGE
VGIWFRFTADTRLNIDVAEFYDDQQHYETGLLLPSVAPSGQHDGGNESVWDLQSRHHVVE
RSVFTRDYNYRNAPEDMNLNVNVSRGDSTTYGEAYHWADNYLTPGNRFQHTPDPESGAFY
ARIRHERYLNQQTRLNGETNCAALAPGQQLKVSGGEEVTDVWRQGVAIAAIHCRARRDRS
FVMTFQAIPCVETYCFRPAVISKPRMAGTLPARVTSTKINDLYGHIDRDGRYRVNLLFDR
DRWQPGEESLWVRQARPYAGETFGLHLPLLAGTEVAIAFEQGDPDRPYIAGALHDSTHQD
HVTLYNYKRNVLRTPANNKIRLDDTRGKEHVKVSTEYGGKSQLNLGHLVDHQNTPRGEGF
ELRTDSYGAIRGGKGIFITADEQLKAMGATVEMDPASQLLGSAVVQLNDWQEIARTHYNT
PPDVSTLKQFVGKAVNLASPVLLMSAPKGIGIVTAETTLLQSGKGLYLQSASDIALASGN
RLSVNSKNAISLLSHREGMRMVSVKGPLEIESHGDTLALTSLKEITVQSTQGHLQLTAKN
GITLGCGGGYIRLTPQGEIHLHSPSLLSFKGTHKMQGPAGETFPLPDLPTSICKDCLIRA
QELAQAFVPRAA
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgagtgacataaagcctctgttgttcaaccacagccatcatctgttacaggtgcatggt
tgtaactcgttgctggatgttctgtgctttgaaggtgaggaaaacttaagtgagcctttc
cgctataccattgaatttaccagcagcgataaagctatcaccccgcagcagatgttgctg
caaaacgcctcgctgaccttgcaggcgccggttgaccagggatttggcattaagatccag
cagccggtgcgcgttcttcagggagtgatcacctcttttgaacggctttccatcgcaaaa
gaggaaacgcgctacgccttgacgttacagccgcgtctggcgctactgtcgaagagtcat
cagaaccgtatttatcaggatatgtcggcaccgcagattgtggagcacattctcagaacc
cgtcaccagatgcgcggggaagattttgtctttcaactggcgcatgaatacccgcagcgt
gaacaggtgatgcagtacggcgaggacgatctgacctttatctcccgcctgttgggtgaa
gtggggatctggtttcgctttaccgccgatacccggctgaatattgatgtggcggagttc
tacgatgaccagcaacactacgagacgggactgttgttgccttcggtcgctccctccggg
cagcatgacggcgggaacgaatcggtgtgggatttacagagccgacaccacgtggttgag
cgttcggtgtttactcgtgactataactaccgtaacgcgccagaggatatgaatctcaac
gtcaatgtcagccgtggcgatagtaccacctacggtgaagcctatcactgggcggacaac
tatctgacgccgggtaatcgcttccagcatactccggacccggagagcggggccttttat
gcccgtattcgtcatgagcgttatctcaaccagcagacgcggctgaatggggaaaccaac
tgcgcggcgctggctcccggccagcagctaaaagtgagcggcggcgaagaggtgacggac
gtctggcgacagggggtggcgatcgctgcgattcactgccgcgcccgtcgcgaccgcagc
ttcgtcatgacgtttcaggctattccctgcgtagagacttactgctttcgcccagcggtc
atcagcaaacccagaatggccgggacgctgccggcgcgcgtcaccagcaccaaaatcaac
gatctctatggccatatcgatcgcgacggacgttatcgggtgaacttattgttcgatcgc
gatcgctggcagccgggtgaggaaagcctgtgggtgcgccaggcgcgcccttacgccggt
gaaacctttggcctgcatctgccgttgttagcgggcaccgaagtggcgatcgcttttgag
cagggggatcccgataggccctatattgccggcgcgctgcacgactccacgcaccaggac
cacgtgacgctctacaactacaagcgtaacgtgctgcgcacgccggcgaacaacaagatt
cgcctcgatgatacacggggtaaagagcacgttaaggtcagcaccgaatatggcggcaag
agccagctcaacctcggtcatctggtggatcatcagaacacgccgcgcggtgagggattt
gagttacgcaccgacagctacggcgcgatccgcggcgggaagggaatatttattaccgcc
gatgaacagctgaaagcgatgggcgcgaccgtggaaatggatcccgcgagtcaattgctc
ggcagtgccgttgttcagctcaacgactggcaggagatagcccgcacccactacaacacc
ccgccggatgtcagcacgttaaagcagttcgtcggcaaagccgtcaatctggcgagcccc
gtcctgctgatgagcgcgccgaaaggcatcggcatcgtgacggcggaaacgacgctgcta
cagagtggtaaagggttgtacctgcaaagcgccagcgatattgcgctggccagcggcaac
cggctatcggtgaatagcaaaaacgcaatctcgctgctttctcaccgcgaagggatgcgt
atggtatcggtgaaaggaccgctggaaatagagtcgcacggcgacacactggcgctcact
tcactgaaggaaattaccgttcagtcaacgcagggacatctgcagcttaccgccaaaaat
ggcatcaccctgggctgcggcggcggctacatccgcctgacgccgcagggagaaatccat
cttcacagcccgagtctgctcagttttaaaggcacgcataagatgcaggggccggccggc
gagacgtttccgcttcccgatcttcccacatcgatatgtaaagactgcctgattcgtgcg
caagaactggctcaggcttttgtgccccgcgccgcctga

DBGET integrated database retrieval system