KEGG   Klebsiella aerogenes KCTC 2190: EAE_22855Help
Entry
EAE_22855         CDS       T01529                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:eae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EAE_22855 (ruvA)
Enzymes [BR:eae01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EAE_22855 (ruvA)
DNA repair and recombination proteins [BR:eae03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EAE_22855 (ruvA)
    RecFOR pathway proteins
     EAE_22855 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH Transposase_20 HHH_3 HHH_8 LcrG
Motif
Other DBs
NCBI-GeneID: 10794787
NCBI-ProteinID: YP_004594749
UniProt: A0A0H3FUI2
Position
complement(4861703..4862314)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVASLVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTTPAGPTADDAEQEAVAALVALGYKPQEASRM
VSKIARPDANSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcattctcgaaaagcaacccccgctggtattactggaa
accgggggcgtaggttatgaagtccatatgccgatgacctgcttctacgagctaccggaa
gccgggcaggaagccatcgtcttcacccattttgtggtacgcgaagacgcgcagctgctg
tacggctttaacaacaagcaggaacgcaccctgtttaaagagcttatcaaaaccaacggc
gtcgggccgaagctggcgctggctatcctttccggcatgtcggcgcagcagtttgtgaac
gcggttgagcgtgaagaagtcgcctcgctggtgaaactgccgggtatcggcaagaaaacc
gccgagcgtttaatcgtcgagatgaaagatcgcttcaaaggcctgcatggcgacctgttt
actccggccgccgatctggtgctgaccacgcctgccggcccaactgccgacgacgcggag
caagaagcggttgccgcgctggtggcgctgggctataaaccacaagaggccagccggatg
gtgagcaaaatcgcccgtccggatgctaacagtgaaacgctaatccgcgaagcgctgcgc
gcggcgttgtga

DBGET integrated database retrieval system