KEGG   Ensifer adhaerens Casida A: FA04_02675Help
Entry
FA04_02675        CDS       T04507                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00740  Riboflavin metabolism
eah00790  Folate biosynthesis
eah01100  Metabolic pathways
eah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    FA04_02675
   00790 Folate biosynthesis
    FA04_02675
Enzymes [BR:eah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     FA04_02675
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     FA04_02675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ANK71632
Position
584020..585120
Genome map
AA seq 366 aa AA seqDB search
MSYDQKRVVDAIRAFEAGEIVVVTDDDGRENEGDLIVAAVHCTPEKMAFIVRHTSGIVCT
PMPREEAKRLNLNAMVAENDSAHTTAFTVSVDFKHGTTTGISADDRTLTVRNLANPNVGP
TDFVRPGHIFPLVAREGGVLMRSGHTEAAVDLCRLASLPPIGVICELVNDDGTVMRGPQV
ASFADTHGLKQVSVADLIAYRQRKETLIEHGGSFDIETPYGPAKGHSYSLPWDPMQHLAV
VFGDIRDGVDIPVRLHLENVGADVFGRDCQIDRIMKRIADEGRGVIVYLREGSVGVGVSQ
TARKGKHEREAHDEAQARENEWLEIGLGAQILKDLGISSIRLLASRERHYVGLEGFGIKI
VGTDII
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatgatcagaagcgtgtcgtcgatgccattcgcgccttcgaggccggcgaaatc
gtcgtcgtcaccgatgacgacggccgcgagaacgagggcgacctgatcgtcgcggcggtg
cattgcacgccggaaaagatggccttcatcgtgcgccacacctcgggcatcgtctgcacg
ccgatgccgcgcgaggaggccaagcgcctgaacctcaacgccatggtggcggaaaacgat
tccgcgcacaccaccgccttcacagtctcggtcgacttcaagcacggcacgacgacgggc
atttccgccgacgaccgcacgctgacggtacgcaacctcgccaatcccaatgtcgggccg
acggacttcgttcgccccggccacattttcccgctggtcgcgcgcgaaggcggcgttctc
atgcgctccggccatacggaagctgccgtcgacctctgcaggctcgccagcctgccgccg
atcggcgtcatctgcgaactcgtcaatgacgacggcaccgtcatgcgtgggccgcaggtg
gcgagcttcgccgacacccatggcctgaagcaggtttcggtcgccgatctcatcgcctat
cgtcagcgcaaggaaacgctgatcgagcatggcggctccttcgatatcgagacgccctat
ggtccggccaagggacattcctattctctgccctgggatccgatgcagcatctcgccgtc
gtctttggcgacatccgtgacggcgtcgatatcccggttcgcctgcatctcgaaaatgtc
ggcgccgacgtcttcggcagggactgccagatcgaccgcatcatgaagcgcattgccgat
gagggcaggggggtcatcgtctatctgcgcgaaggctcggtcggcgtcggcgtgtcgcag
acggcgcgcaagggcaagcacgagcgcgaagcgcacgacgaggcgcaggcgcgcgaaaac
gagtggctggaaatcggcctcggcgcgcagatcctgaaggatctcggcatcagctccatc
aggctgctcgcttcgcgtgaacgccactatgtcggcctcgaaggcttcggcatcaagatc
gtcgggaccgacatcatctaa

DBGET integrated database retrieval system