KEGG   Ensifer adhaerens Casida A: FA04_06175Help
Entry
FA04_06175        CDS       T04507                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00020  Citrate cycle (TCA cycle)
eah00620  Pyruvate metabolism
eah00650  Butanoate metabolism
eah01100  Metabolic pathways
eah01110  Biosynthesis of secondary metabolites
eah01120  Microbial metabolism in diverse environments
eah01130  Biosynthesis of antibiotics
eah01200  Carbon metabolism
Module
eah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FA04_06175
   00620 Pyruvate metabolism
    FA04_06175
   00650 Butanoate metabolism
    FA04_06175
Enzymes [BR:eah01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     FA04_06175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom Antimicrobial_2
Motif
Other DBs
NCBI-ProteinID: ANK72250
Position
1282483..1284003
Genome map
AA seq 506 aa AA seqDB search
MSHVPPTDLEARIRCKSLRDRIATPEEAAALIKDGMTIGMSGFTKAGDAKAVPLAMAERA
AREKFRITLMTGASLGHDIDKTLTEAGVLARRLPFQSDPVLRAAINRGEVMFIDQHLSET
VEQLRSGQISPIDYAVVEAVAITEDGGIVPSTSVGNSASFAILAKKVIVELNLSHSPELE
GLHDIFIPAKRPSRTPIPVVACDSRAGSPYIPVDPEKIVAIVVTEKEDSAARISPPDAET
TAIAGHLIAFLQEEVRKGRLDMTLNPLQAGIGVIANSVLSGLVDSPFHDLRMYSEVLQDS
TFELFEAGKLSFASASSMTLSSAWADRVFRNIRAYKDKLVLRPQEVSNHPEIIRRLGVIG
INTALEFDIYGNVNSTHVGGTDMMNGIGGSGDFARNAFLSIFVAKSVAKGGAISSVVPMV
SHVDHTEHDVDILVTEHGLADLRGLAPRERAPVIIENCCHPAYRELLSDYFNRAVATRGG
QTPHILEEAFDWHVRRLKTGSMMPTA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgttccgccaaccgacctggaagccaggatccgctgcaaatcgctgcgtgat
cgcatcgctacgccggaagaggcggccgcgctgatcaaggacggcatgaccatcggcatg
agcggcttcaccaaggccggtgacgcgaaggccgtgccgcttgccatggccgaacgggcc
gcacgggagaagtttcgcatcacgctgatgacgggcgcctcgctcggtcatgacatcgac
aagacgctgacagaggcgggtgttcttgcccggcgcctgccgttccagtcggacccggtt
ctgcgagcggcgatcaaccgcggcgaggtgatgttcatcgatcagcatctctcggaaacc
gtcgagcagttgcggtccggccagatcagcccgatcgactatgcagtggtcgaggcggtg
gcgatcaccgaagacggcggcatcgttccgtcgacatcggtcggcaattcggcaagcttc
gcgatcctggcgaagaaggtgatcgtcgagctcaatctcagccacagtcccgaactcgaa
ggcctgcacgatatcttcattccggcgaagcgaccgagccgcacgccgatcccggtcgtt
gcctgcgatagccgtgcgggctcgccctacattcctgtcgatccggaaaagatcgtcgca
atcgtcgtcaccgagaaagaggacagcgccgcacggatctctccgccggatgcggagacg
acggcgatcgccggccatctgatcgccttcttgcaggaggaggtgcgcaagggccgcctc
gacatgacgctcaacccgctgcaggcgggcatcggcgtcatcgccaattcggtgctgagc
ggcctggtcgacagtccgttccatgatctgcgtatgtatagcgaggtgctgcaagacagc
acgttcgagcttttcgaggccggcaagctgagcttcgcctcggcctcgtcgatgacgctt
tccagcgcctgggctgatcgcgtgttccgcaacatccgcgcctacaaggacaagctggtg
ctgcggccgcaggaggtgagcaatcatccggagatcattcggcgcctcggtgtcatcggc
atcaacacggcgctcgaattcgatatctacggcaacgtcaactcgacccatgtcggcggt
accgacatgatgaacggtatcggcggctccggcgatttcgcccgcaacgccttcctgtcg
atcttcgtcgccaagtcggttgccaagggcggggcgatatcgtctgtcgtgccgatggtg
tcccatgtcgaccacacggagcacgacgtcgatattctggtgaccgagcatggtcttgca
gatctgcgcggcctggcgccgcgggagcgcgcacccgtcatcatcgaaaactgctgccac
ccggcctatcgggagcttttgtcggattacttcaatcgtgcggtcgccacccgtggcgga
cagaccccgcatattctggaagaggctttcgactggcatgtgcgccggctgaagaccggc
agcatgatgccgacggcctga

DBGET integrated database retrieval system