KEGG   Ensifer adhaerens Casida A: FA04_06455Help
Entry
FA04_06455        CDS       T04507                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00520  Amino sugar and nucleotide sugar metabolism
eah01100  Metabolic pathways
eah01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FA04_06455
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    FA04_06455
Enzymes [BR:eah01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FA04_06455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 TcpA GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: ANK74746
Position
1350364..1351443
Genome map
AA seq 359 aa AA seqDB search
MSGGALSLWLRAGQPALYAFGMSESKAFISGCKGLSLTSDERDFFAGERPWGFILFGRNI
GEEQQISDLVAALRDSIGNPNAPVLIDQEGGRVQRIRPPLVQQYPNGAAIGEIYRRDAKL
GLRAAWLMGRLHAFDLMRFGITVDCLPVLDVPVPGSHDVIGNRAYGHDPETVTAIGRAMG
EGLKAGGMLPVMKHMPGHGRTFVDSHHNLPVVSATFDELAASDFLPFVAMKDEVMAMSAH
MVFTTIDPDNPATTSAKVVREIIRGHIGFDGLLMSDDVSMNALAGDMTTRARNIIAAGLD
LVLHCHGIMEEMKAVADVVPVLAGESLRRARAAEAAFRAPDGASEVDLRAEFNALFATV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggggggcgctgtctttgtggcttcgcgccgggcagcccgcgctctatgctttt
gggatgagcgaatcaaaagcatttatctccggctgcaagggcctttccctcacgagcgac
gagcgcgatttctttgcaggagaacgcccctggggcttcatcctcttcggtcgcaacatt
ggcgaggagcagcagatctcggatctggtggcagcccttcgcgacagcatcggcaatccc
aatgcgcccgtgctcatcgaccaggaaggcggacgcgttcagcgcatccgcccaccgctc
gttcagcagtatccgaatggcgcggcgatcggcgaaatctaccgccgcgacgcgaagctc
ggtctgcgcgccgcctggctgatgggacgcctgcacgcctttgacctgatgcgcttcggc
atcaccgtcgattgcctgcctgtgctcgacgtgcccgtgcccggcagccacgacgtcatt
ggcaatcgcgcctatgggcacgatcccgagaccgtcacggctatcggccgtgcgatgggc
gaggggctgaaggccggcggcatgctgcctgtaatgaagcatatgccgggccacggacgc
accttcgtcgactcgcaccacaacctgcctgtcgtcagcgccacattcgatgagcttgcc
gcgagcgacttcctgcccttcgttgcgatgaaggacgaggtgatggcgatgtcggcgcac
atggtgttcaccacgatcgacccggacaatccggcgaccacctctgcgaaggtcgtgcgc
gagatcattcgcggccatatcggtttcgacggcctgctgatgtcggatgacgtgtcaatg
aacgcgcttgccggcgacatgacgacccgcgcgcgcaacatcattgctgcgggacttgat
ctcgtcttgcattgtcatggcataatggaggaaatgaaggccgtcgcggatgtcgtgccg
gttctggccggcgaaagcttgcgccgggcgcgggccgccgaagccgcgttccgggcgcct
gacggtgcgagcgaagtcgatctgcgggcggagttcaatgccctgtttgcaaccgtctga

DBGET integrated database retrieval system