KEGG   Ensifer adhaerens Casida A: FA04_06495Help
Entry
FA04_06495        CDS       T04507                                 

Definition
(GenBank) 5'/3'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00230  Purine metabolism
eah00240  Pyrimidine metabolism
eah00760  Nicotinate and nicotinamide metabolism
eah01100  Metabolic pathways
eah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    FA04_06495
   00240 Pyrimidine metabolism
    FA04_06495
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    FA04_06495
Enzymes [BR:eah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     FA04_06495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE MtmB
Motif
Other DBs
NCBI-ProteinID: ANK72310
Position
1357564..1358334
Genome map
AA seq 256 aa AA seqDB search
MRILLTNDDGIHAEGLSVLERVARTISDDVWVVAPEADQSGLAHSLTLSEPLRLRQIAEK
RFALRGTPTDCVIMAVRKVLDRKPDLVLSGVNIGANMADDVTYSGTVAGAIEGTLQGIRS
IALSQAYNHAVGKTVPWDVVETHAPALVRKLMKVDLPDGTLLNVNFPNCSADAIAGTEVT
SQGKLDFGLSIDERTDGRGFPYFWLRFGERFGDFRAGTDIHALRENMISVTPLKLDLTDY
SVQDRLARALNEGAVA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcctgctgacaaacgatgacggcattcacgccgagggcctgtcggtacttgaa
cgcgtcgcccggacgatttcggacgatgtgtgggtcgttgcgcccgaagcggaccagagc
ggccttgcccattcgctgaccctgtcggagccattgcggctgcgacagatcgcggaaaag
cgcttcgcacttcgcggcacgccgaccgattgcgtcatcatggccgtccgcaaggtgctc
gatcgcaagcccgatctcgtgctgtccggcgtcaacatcggcgccaacatggccgacgac
gtgacctattccggtaccgtcgccggcgccatcgaaggaacgttgcagggcatccgctcg
atcgcgctgagccaggcctacaatcacgccgtcggaaagaccgttccgtgggatgtcgtc
gaaacgcacgcgccggccttggtccgcaagctgatgaaggtggatctgcctgacggcacg
ctgctcaacgtcaacttccccaattgctcggcggacgctattgccggtacggaggtgacg
tcgcaaggcaagctcgacttcggcctgtcgatcgacgagcgaaccgatggccgcggcttt
ccctatttctggctgcgtttcggcgaacgcttcggcgatttccgcgccggaaccgacatt
cacgccctgcgtgaaaacatgatctcggtcacgccgctcaaactcgaccttaccgactac
agtgtccaggatcgcctggcgcgggcgctcaacgagggagccgttgcttga

DBGET integrated database retrieval system