KEGG   Ensifer adhaerens Casida A: FA04_15245Help
Entry
FA04_15245        CDS       T04507                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00260  Glycine, serine and threonine metabolism
eah01100  Metabolic pathways
eah01110  Biosynthesis of secondary metabolites
eah01120  Microbial metabolism in diverse environments
eah01130  Biosynthesis of antibiotics
eah01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FA04_15245
Enzymes [BR:eah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FA04_15245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 ELFV_dehydrog_N SdiA-regulated
Motif
Other DBs
NCBI-ProteinID: ANK73858
Position
3116230..3117276
Genome map
AA seq 348 aa AA seqDB search
MIFSSDNWAGAHPAIAESLMAHAGGYASAYGTSELDRKVEKKFADIFERDVAVFFVGTGT
AANSLALATANRAGGVAFCHREAHVIADECGAPEFFSHGARLKPVDGPRGKMEASRLEAE
IRRFPLDNVHGGQPSAVSLTQATESGTVYSLAEIEAISAVAKGHRLPLHMDGARFANALV
SLDVTPAEMTWKRGVDLVSFGGTKNGCWCAEALVLFDLSKAHEMHFLRKRSAQLFSKSRF
VSAQFDAYFAGDLWLNLARHANAMATRLAEGIAAAKTSRLAWQADANEVFAIINKDVAAK
LRQDGAVFYDWPVPHDLEGKLAKNEGLYRLVTSFATKAEDVDRFVASC
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgattttttcgtctgataactgggctggcgcccatcccgcgattgccgaaagcctgatg
gcccatgccggcggctacgcgtcggcctatggcaccagcgagcttgaccggaaggtggag
aagaagttcgcggacatcttcgaaagggacgtcgccgtcttcttcgtcggcaccggaaca
gccgccaattcgctggcactggcaacagccaaccgcgccggcggcgtcgccttctgccat
cgcgaggcccatgtcatcgccgacgaatgcggcgcgcccgaattcttttcgcatggcgcc
cgactgaaacccgtcgacggaccgcggggcaagatggaggcctcccgccttgaagccgag
atccggcgcttcccgctcgataacgtccatggcggccagcccagtgcggtatcgctgacg
caggcgacggaaagcggcacggtctattcgctcgccgaaatcgaagcgatctcggccgtc
gccaagggacacaggctgccgctgcacatggatggtgcgcgcttcgccaacgcgctggtc
agcctcgacgtaacgcccgccgaaatgacctggaagcgcggcgtcgacctcgtctccttc
ggcggcaccaagaacggctgctggtgcgccgaggcgctggtgctgttcgacctctccaag
gcccacgagatgcacttcctgcgcaagcgctccgcccagcttttctccaagtcgcgtttc
gtctcggcgcagttcgacgcctatttcgccggcgatctctggctgaatctcgcccgtcac
gccaacgccatggccacacgcctggccgagggcattgccgccgcaaagacgagccggctt
gcctggcaggccgatgccaacgaggtcttcgccatcatcaacaaggatgtggcggcgaag
ctcaggcaggatggcgccgtcttctacgactggccagtgccgcacgacctcgagggcaag
cttgctaagaacgagggcctctatcgcctcgtcaccagctttgcgaccaaggccgaggac
gtcgaccgcttcgtcgccagctgctga

DBGET integrated database retrieval system