KEGG   Ensifer adhaerens Casida A: FA04_15920Help
Entry
FA04_15920        CDS       T04507                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00071  Fatty acid degradation
eah00072  Synthesis and degradation of ketone bodies
eah00280  Valine, leucine and isoleucine degradation
eah00310  Lysine degradation
eah00362  Benzoate degradation
eah00380  Tryptophan metabolism
eah00620  Pyruvate metabolism
eah00630  Glyoxylate and dicarboxylate metabolism
eah00640  Propanoate metabolism
eah00650  Butanoate metabolism
eah00900  Terpenoid backbone biosynthesis
eah01100  Metabolic pathways
eah01110  Biosynthesis of secondary metabolites
eah01120  Microbial metabolism in diverse environments
eah01130  Biosynthesis of antibiotics
eah01200  Carbon metabolism
eah01212  Fatty acid metabolism
eah02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FA04_15920
   00630 Glyoxylate and dicarboxylate metabolism
    FA04_15920
   00640 Propanoate metabolism
    FA04_15920
   00650 Butanoate metabolism
    FA04_15920
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FA04_15920
   00072 Synthesis and degradation of ketone bodies
    FA04_15920
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FA04_15920
   00310 Lysine degradation
    FA04_15920
   00380 Tryptophan metabolism
    FA04_15920
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FA04_15920
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FA04_15920
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FA04_15920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eah04147]
    FA04_15920
Enzymes [BR:eah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FA04_15920
Exosome [BR:eah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FA04_15920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANK73979
Position
3260942..3262123
Genome map
AA seq 393 aa AA seqDB search
MSRTDPIVIVSAARTPMGAFQGSLKDLTAPEIGAIALKAALDRAGLDAVDEVLMGNVLPA
GIGQNPARQAALGAGLGKETPSTTISKVCGSGMKALMLGHDALLSGSASVLAVGGMESMT
NAPYLLPKARGGFRLGHGEVKDHMFLDGLEDAYSGRLMGTYAEDTAEHYQFSRADQDGFA
LRSLERATRAAEDGSFAEEVVAVAGAGKRQTANLDRDEQPTKSDPSKIPKLKPAFRDGGS
VTAANSSSISDGAAALILMRASEAEKRGLTPLAIVAGHAGHAQEPAWFTTAPIGAIDKLL
ARLAWEKGSVGLYEINEAFAVVAMAAIRDLGLSDEIVNINGGACALGHPIGASGARIIVT
LLHAMRAKGVKRGIASLCIGGGEATAVGLELLQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaactgacccgatcgtcatcgtttcggcggcccgcacgccaatgggcgccttt
cagggcagcctcaaggatttgaccgcgccggaaatcggcgccatagcgctcaaagccgca
ctcgatcgtgccggccttgatgctgtcgacgaggtgttgatgggcaatgtgctgccggcc
ggcattggccagaacccggcgcgccaggcagcccttggcgccggcctcggcaaggaaacg
ccgtcgacgaccatctccaaggtctgcggctccggcatgaaggcgctgatgcttggccac
gatgctctgctgtccggtagcgcgtcggtgcttgcggtcggcggcatggagtcgatgacc
aacgcgccctatctgctgccgaaagcgcgcggcggcttccgcctgggtcatggcgaagtc
aaggaccacatgttcctcgatggcctcgaagacgcctattccggccggctgatgggcacc
tatgccgaggacacggccgagcactatcagttctcgcgcgccgatcaggacggctttgcg
ctgcgatctctggagcgcgcaacccgcgcagctgaggatggttcctttgccgaggaagtc
gtggcagtcgctggcgccggcaagcgccagaccgccaatctcgaccgcgacgaacagccg
accaaatcggatccgtcaaagatcccgaagctgaaacccgccttccgcgacggcggcagc
gtgacggccgccaattcgtcgtcgatatcagacggggcagcggcgctgatcctgatgcgc
gccagcgaagcggaaaagcgtgggctgaccccgcttgctatcgtcgcgggccatgcgggc
cacgcccaggagccggcctggttcacgacggccccgattggcgcaatcgacaagctgctg
gcaaggctcgcctgggagaagggcagcgtcggcctctacgaaatcaacgaggccttcgcc
gtggtggcgatggcggcgatccgcgacctcggcctgtcggacgagatcgtcaacatcaac
ggcggcgcctgcgcgctcggccacccgatcggcgcatccggcgcccgcatcatcgtgaca
ttgcttcacgccatgcgcgccaagggcgtcaagcgcggcatcgcctcgctctgcatcggc
ggcggcgaggcgacggcggtcgggcttgagctgttgcaatag

DBGET integrated database retrieval system