KEGG   Ensifer adhaerens Casida A: FA04_18380Help
Entry
FA04_18380        CDS       T04507                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
eah  Ensifer adhaerens Casida A
Brite
KEGG Orthology (KO) [BR:eah00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FA04_18380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ANK74404
UniProt: A0A2V4XAY7
Position
3806224..3807228
Genome map
AA seq 334 aa AA seqDB search
MDATLAFPLLVGLIGIALFFDFLNGLHDAANSIATIVSTRVLRPQYAVMWAAFFNFIAFL
FFGLHVAETLGKGIIDPGIVTPLVIFSALIGAIVWNIVTWLFGIPSSSSHALIGGLVGAG
LASTGFSSIVWTGLLKTVGAIFMSPAIGFFLALMLVLIVSWIFVRQTPFAVDRTFRVMQF
VSASLYSLGHGGNDAQKTMGIIAVLLYSQGYLGSEFYVPFWVVITCQAAIALGTLFGGWR
IVHTMGSKITRLNPMQGFCAETGGAITLFAATWLGIPVSTTHTITGAIIGVGAARRVSAV
RWGLAGNIVIAWFITMPAAAAISALAYFTIDLLF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgacgctcgcctttccgttgctcgtcgggctgatcggcatcgcgctgttcttc
gacttcctgaacggtctgcacgacgccgccaactcgatcgcgacgatcgtctcgacacgg
gtgctgagaccgcagtacgcggtcatgtgggcggcctttttcaacttcatcgccttcctg
ttcttcggcctgcacgtggccgagacgctgggcaagggcatcatcgatcccggcatcgtc
acgccgctggtgatcttctcggcgctgatcggcgcaatcgtctggaacatcgtcacctgg
ctcttcggcatcccgtcgagttcgtcgcacgcgctgatcggcggcctcgtcggtgccggt
cttgcgagcaccggtttcagttcgatcgtctggaccggcctcctgaagaccgtcggcgcg
atcttcatgtcgccggcgatcggctttttcctggcgctcatgctggtgctgatcgtttcc
tggatcttcgtgcgccagacgccctttgccgtcgaccgcaccttccgcgtcatgcagttc
gtctcggcctcgctctattcgctcggccatggcggcaacgacgcgcagaagaccatgggc
atcatcgcggtgctgctctactcgcaaggctatctcggctcggagttctatgtgccgttc
tgggtggtgatcacctgccaggcggcgatcgcgctcggcacgctgttcggcggttggcgc
atcgtccacaccatgggctcgaagattaccaggctcaatccgatgcagggcttctgcgcc
gagaccggcggagcgatcacgctttttgccgccacctggctcggcatcccggtctcgacg
acgcacaccatcaccggagcgatcatcggcgttggtgctgcgcgtcgcgtttcggccgtg
cgctgggggcttgccggcaatatcgtcattgcctggttcatcaccatgcccgccgcagcg
gcgatttcggcgctcgcctacttcaccatcgatctgctgttctga

DBGET integrated database retrieval system