KEGG   Ensifer adhaerens Casida A: FA04_32205Help
Entry
FA04_32205        CDS       T04507                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FA04_32205
Enzymes [BR:eah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     FA04_32205
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     FA04_32205
    1.1.1.-  
     FA04_32205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 ADH_N_assoc Methyltransf_25 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ANK77312
UniProt: A0A2V4XSP6
Position
pCasidaAB:1023289..1024362
Genome map
AA seq 357 aa AA seqDB search
MKALRFHAAKDLRIDDVDAPPAPGPGEVLVENRFCGICGTDLHEYAYGPIFIPKEPHPFT
GAHGPQILGHEFGGVVKAIGEGVSHVKPGDRVSVQPLIMPRRGDYYADRGLFHLSANLAL
AGLSWHSGGMAEAALLNDYNVQPIPDALSDEEAALIEPTAVAVYACDRGSVTAGNSVLVT
GAGPIGILVAMAARAAGASKIFLSDLNETRLSLAKEALREVRTINPKIEKVSDVVQAETE
GGVGCDVAIECVGNEHALKNCASAVRKQGVVVQTGLHPGENPLNWFDVTFKDIDIRGSWA
YPTHYWPRVARLIASGQIPARRIVTKHVSLSEAVSAGFDQLLDPAGTHLKILIDLKR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctgcgctttcacgccgccaaggacctacgcattgacgatgtcgacgctccg
cctgcccctggccccggtgaggtactggtggaaaatcgtttctgcggcatctgcgggacc
gatctgcacgaatacgcctatggcccgatcttcatcccgaaggaaccgcatcccttcacg
ggtgctcatggaccgcagatcctcggccatgaattcggcggcgtcgtgaaggcgatcggc
gaaggggttagccatgtgaagccgggcgacagggtctccgtccagccgctgatcatgccg
cgccgcggagactattatgccgatcgtggtctgtttcacctgagcgccaacctggcactg
gccggcctatcctggcactccggcggaatggcggaagcggcgctgctcaacgactacaat
gtccagcccattcccgatgcgctatccgacgaagaagccgcgctgatagagccgaccgca
gtcgccgtatatgcgtgcgatcgcggcagcgtcaccgccggcaacagcgtgctggtcacg
ggcgcaggaccgatcggcattctcgttgccatggcagcgcgggcggccggcgcgtcgaag
atttttctctccgatctcaacgagacgcggctttcactggcgaaggaagcactccgcgag
gtccgcaccatcaatcccaagatcgaaaaggtcagcgatgttgtccaggccgaaaccgag
ggcggcgttggctgcgatgtcgccatcgaatgcgtcggcaacgaacatgcgctcaagaac
tgcgcgagcgcggtgcgcaagcagggcgtcgtcgtgcagaccggccttcatccaggcgag
aacccgctgaactggttcgacgtgaccttcaaggacatcgatatccgcggttcctgggcc
tatccgacccactactggccgcgcgtggcgcgcctgatcgcgagcggccaaataccggct
cgccgcatcgtcaccaaacatgtctcactgagcgaagctgtttcggcagggttcgaccag
ttgctcgatcccgccggtacgcacctgaaaatactgatcgacctcaagcgttag

DBGET integrated database retrieval system