KEGG   Equus asinus (ass): 106822956Help
Entry
106822956         CDS       T04645                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2-like
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
eai  Equus asinus (ass)
Pathway
eai04010  MAPK signaling pathway
eai04218  Cellular senescence
eai04370  VEGF signaling pathway
eai04625  C-type lectin receptor signaling pathway
eai04722  Neurotrophin signaling pathway
eai05167  Kaposi sarcoma-associated herpesvirus infection
eai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106822956
   04370 VEGF signaling pathway
    106822956
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    106822956
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106822956
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    106822956
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    106822956
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    106822956
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eai01001]
    106822956
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106822956
Protein kinases [BR:eai01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   106822956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase
Motif
Other DBs
NCBI-GeneID: 106822956
NCBI-ProteinID: XP_014683884
Position
Un
AA seq 168 aa AA seqDB search
MWSLGVIMYILLCGYPPFYSNHGLAISPGMKSRIRMGQYEFPNPEWSEVSEEVKMLIRNL
LKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAREGGVL
SSDRRAQRIRVLVTADTSDVNQSPTPPFSPDPDTSRIPQPKDATAHCG
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccttgggtgtcatcatgtacatcctgctgtgtgggtatccccccttctattcc
aaccacggccttgccatctctccgggcatgaagagtcgcatccgaatgggccagtatgaa
tttcccaaccctgaatggtcagaagtatcagaggaagtgaagatgcttatccggaacctg
ctgaaaacagagcccactcagaggatgaccatcacggagttcatgaaccacccctggatc
atgcaatcaacgaaggtccctcaaaccccactgcacaccagccgcgtcctgaaggaggac
aaggagcggtgggaggatgtcaaggaggagatgaccagtgccagggaaggaggagttctc
tcaagtgacaggagagctcagaggatcagggttcttgtcactgctgacacctctgatgtg
aaccaatcaccaacgccccccttctccccagaccccgacaccagccggatcccccagccc
aaggatgccacagcccactgtggctaa

DBGET integrated database retrieval system