KEGG   Equus asinus (ass): 106826586Help
Entry
106826586         CDS       T04645                                 

Gene name
TTN
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
eai  Equus asinus (ass)
Pathway
eai05410  Hypertrophic cardiomyopathy (HCM)
eai05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    106826586 (TTN)
   05414 Dilated cardiomyopathy (DCM)
    106826586 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eai01001]
    106826586 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eai04131]
    106826586 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:eai04812]
    106826586 (TTN)
   04147 Exosome [BR:eai04147]
    106826586 (TTN)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106826586 (TTN)
Protein kinases [BR:eai01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106826586 (TTN)
Membrane trafficking [BR:eai04131]
 Others
  Actin-binding proteins
   Others
    106826586 (TTN)
Cytoskeleton proteins [BR:eai04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     106826586 (TTN)
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106826586 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Ig_6 Pkinase fn3_4 Titin_Z C1-set Tissue_fac Ig_5 Pkinase_Tyr SusE Adeno_E3_CR1 PPAK THB Ig_4
Motif
Other DBs
NCBI-GeneID: 106826586
NCBI-ProteinID: XP_014689468
Position
Un
AA seq 33468 aa AA seqDB search
MATQAPTFTQPLQSVVVLEGSTATFEAHVSGLPVPEVSWFRDGQAISTSTLPGVQISFSD
GRARLTIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGELYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIVSTAQISETRQTRIEKKIEAHFDARSIATVEMV
VDGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPTPSP
VRSVSPAGRISTSPIRSVKSPLLVRKTQTSTLAQGPEVPPPWKQEGYVASSEAEMRETTV
TSATQIRTEERWEGRYGVQEEVTISGAAGAAASVSVSAAFAAGAVATGAAEVKQETDKSA
AVATVVAAVDMARVREPVISAVEQTAQRTTTTATHIQPAQEQIRKEAEKTAVTKVVVAAD
KAKEQELKRTREVITTKQEQVRVTHEQIRKETEKAFVPKVVISAAKAKEQETRITGEITK
KQEQKQITQETIMKETRKTVVPKVIVATPKVKEQDLVSRTREGITTKREQVEITQEKMRK
EAEKTALSTIAVATTKAKEQETILRTREAKATRQEQIQVTQEKVDVGKKAEAVATVVAAV
DQARVREPRAPAHLEESYAQQTTLEYGYKEHISATKVAEHPQRPASEPHVVPKAVKPRVI
QVPSETHVTTTDQMGMQISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTDHG
YEASIAGTAIATLQKELSATSPAQKITKSVKAPTVKPAETRVRAEPTPSPQFPFADIPET
YKSQAGIEVKKEVGVSIAGATVREEHFEVLHGREVKVTEAARVPAPVEIPVTPPTLVSGL
KNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQSGIARLMIREAFAED
SGRFTCSAVNEAGTVSTSCYLAVQASEEFEKETTAVAEKVTTEEKRFVESRDVVMTDTSI
TEEIAGPGEPAAPFFITKPVVQKLVEGGSIVFECQVGGNPKPHVYWKKSGVPLTSGYRYK
VSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEAEYESLVKSQQEMLY
QTQMTAFVQEPKVGEIAPGFLYSEYEKEYEKEQALIRKKMAKDTVMVRTFVEDQEFHISS
FEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAIESGFELRVKNYRILEGMGVT
FHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNI
KGNAICSGKLYVEPAAPLGAPTYIPTPEPVSRIRSVSPRSVSRSPIRISPARMSPARMSP
ARMSPARMSPGRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETF
WFHDGQQIVNDYTHKVVIKEDGTQSLIIVPAAPSDSGEWTVVAQNRAGRSSISVMLTVEA
VEHQVKPVFVEKLKNVNVKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGT
KGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERRLIIPRGTYRA
KEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPI
GDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYNRDSGVITCRATNKYGTDHTS
ATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEP
VRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGE
VKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPVD
TTETKEVVRLKRAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEE
LLRKTKEELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTV
GQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASI
MVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYK
DGVEIHKGNKYRMHSDRKVHFLSVLTIDPSDAEDYSCVLVEDENVKTTAKLIVEGAVVEF
VKELEDIEVPESFSGELECIISPENIEGKWYHNGVELKSNGKYTITSRRGRQNLTVKDVT
KEDQGEYSFVADGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWM
KDGQEVQSSDRVFIVIDKQSHMLLIEDMTKEDAGNYSFTLPALGLSTSGRVSVYSVDVIT
PLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVHAIVKGTKQRLVINRTHA
SDEGPYKLMVGRVETSCDLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKG
KEIKPNAKYKIEAHGKIYKLTVLNMMKDDEGEYTFYAGENMTSGKLTVAGGAISKPLTDQ
TVAESQEAVFECEVANPDSEGEWLRDGKHLPLSKNIRSESDGHKRRLIIAASKLDDIGEY
TYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVTLTHPNVKGVQWIRNGVVLES
NDKYDVSVKGTTYSLRIKNCAVSDESVYGFKLGRLGASARLHVETVKIIKKPRDVTALEN
ATVAFEVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQHISPSDAGEYTAVVG
QLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKI
VVQGKLHQLLIMNTSTEDAAEYTFVCGNDQVSATLKVTPIMITSMLKDINAEEKDTITFE
VTVNYEGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAAEYTFVAGKATSTA
TLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDGQELQIVDRIKIQKEK
YVHRLLIPSTRMSDAGQYTVVAGGNMSTANLFVEGRDVRIRSIKKEVQVIEKQRAVVEFE
VNEDDVDAHWYKDGIEINFQIQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSV
TLYVNAPEPPQILQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLH
DGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIIT
PLQDTVTSEGQPARFQCSVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPE
DEGTYTFAASNAMGQVSSTANLRLEAHESLLHERIEEQIEVEMKAAPVLRRRIEPLEVAL
GHLAKFTCEIQSAPNVRFQWFKAGRQIYDSDKYSIRSSKYVSSLEILRSQVVDCGEYTCK
ASNEYGSVSCTATLTVTEAYPPTFYSRPKSVTTFVGKAAKFLCTVLGTPVIETVWQKDGA
ALSPSPNCKISDAENKHILELSNLTIQDQGVYSCKASNKFGADICQAELIIIDKPHFIKE
LEPVQSAINKKIHLECQVDEDRKVTVTWKKDGQKLPPGKDFKIYFEDKIASLEIPLAKVK
DSGTYVCTASNEAGSSSSSATVTIREPPSFVKKVEPSYLMLPGESARLHCKLKGSPVIQV
TWFKNNKELNESNTIRMSFVNSEAVLDITDVKVEDSGSYSCEAVNDVGSDSCSAEIVVKE
PPSFIKTLEPADIVRGSNALLQCEVAGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVSLE
IFAFNSADVGEYECVVANEVGKCGCLATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRG
SEPISVTWMKGQEIIKEDGKIKMSFSNGVAVLIIPDVQISFGDRYTCLAENEAGSQTSVG
ELTVKEPAKIIERAELIQVTAGDPATLEYTVTGTPELKPKWYKDGRPLIASKKYRISFKN
NVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSIVSGT
CRLDCKIAGSLPMRVSWFKDGKEIASSDRYRIAFVEGTASLEISRVDMNDAGNFTCRATN
SVGSKDSSGALIVQEPPSFVTKPASKDVLPNSAVCLKSTFQGSTPFTVRWFKGDKELVSG
GSCYITKEALESSLELYAVKTSDSGTYTCKISNVAGSVECSANLFVKEPATFVEKLELSQ
LLKKGDTAELACKVTGTPPIKITWFVNDREIKESSKHRMSFVESSAVLRLTDVATEDSGE
YMCEAQNEAGSDHCTGVLIVKEAPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKD
NTTLRSGRKYKTLIQDQLVSLQILKFVAADAGEYQCRVTNEVGSSTCSARVTLREPPTFV
KRIESTSSLRGGTAAFQATLKGSLPITVTWLKDNDEITEDENIRMTFENNVASLYLSGIE
VKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEIT
AKWFKGGQELTLGQKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCRASINVL
DLIIPPSFTKKLKKMDSIKGSSIDLECIVAGSHPISIQWFKDDQEISASEKYKYSFHDNT
AFLEISHLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKA
LVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTV
TSKVTLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPEIRVSWYLDGNEITAIRKHG
ISFVDGLATFQISGARVENSGTYVCEARNDAGTASCSIQLKVKEPPAFIRELQPVEVVKD
SDVELECEVMGTSPFEVTWLKNNREIRSSKKYTLSDRVSVFYLHITKCDPSDTGEYQCII
SNEGGSCSCSARVSLKEPPSFIKKIENVTTVLKSSATFQSTVAGSPPISVTWLKDDQILD
EDDNVHISFVNNVATLQIRTVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIIEKAKS
VDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMMQDSG
QYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSVHMECKVSGSLPISAQ
WFKDGKEISTSAKYRLVCHENTVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEP
PSFLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNL
YSVDASKTGQYTCQVTNDVGSDSCTTLLFVTEPPKFVKKLEASKIVKAGDSARLECKITG
SPEIRVVWYRNEHELPASDKYRMTFIDSVAVIQMNNLGTEDSGDFICEAQNPAGSTSCST
KVIVKEPPVFSSFPPVVETLKNTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIVSKN
FHASIHILNVETSDIGEYHCKAQNEVGSDTCICTVQLKEPPRFVSKLNSLTVVAGEPAEL
QASIEGTQPIYVQWLKEKEEVIRESENIRITLVENIATLQIARAEPANAGKYICQIKNDG
GTRENMATLTVLEPAVIVEKAGSMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQK
HKFSFYNKISSLKILSVEKQDAGTYTFQVQNNVGKSSCTAVVDVSDRTVPPSFTRRLKDT
GGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGN
YTCVAANVAGSDECRAVLAVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTSPFKVGWFRG
ARELVKGDRCNIYFEDTVAELELFNVDISQSGEYTCVVSNNAGQTFCTTRLYVKEPAAFV
KKLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITPSEKCNIVTTEKTCLLEILNST
KRDAGQYSCEIENEAGKDVCEALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEIT
VSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNIHDSGEYTCKAENSIGTASSKTIFRIQ
ERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVSWYRDGVLLRDDENLQTSFVDNV
ATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESAD
FECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDV
GKDMCSAQLSVKEPPKFVKKLEASKVAKQGESTQLECKISGSPEIKVLWFRNDSELHESW
KYNMSFVNSVALLTINEASTEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGA
LKGSDVVFQCEIAGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHILNLEASDVGEYH
CKASNEVGSDTCVCTVKFQEPPRFVKKLSDTSTLVGDAVELRAVVEGFQPISVVWLKDKG
EVIRESENTRISFIDNVATLQLGSPEASNSGKYVCQIKNDAGMRECSAVLTVLEPARIIE
KPEPMTVTTGNPFALECVVTGTPELSTKWFKDGRELSGDSKHHITFVNKVASLKIPCAEM
SDKGLYSFEVKNSVGKSNCTVSVHVSDRVIPPSFIRKLKDLNAILGSSAVLECRVAGSAP
ISVGWFQDGNEIISGPKCQSSFSENVCTLNLSSLEPSDTGVYTCVAANVAGSDECSAVLT
VQEPPSFEQTPDSVEVLPGVSLTFTSIFRGTPPFKVKWFKGSRELVSGDSCTISLEDYVS
ELELFEVEPLQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEAT
FTGTPPISVSWMKNEFPLSQSQNCSITMTEKSTILEILDSTIEDYAQYSCLIENEAGQDI
CDALVSVLEPPYFIEPLEHVEATIGEPTTLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQ
FKNNVASLVINKVDHSDVGEYSCKAENSVGAVASSAVLVIKERKLPPSFARKLKDVHETL
GFPVAFECRINGSEPLQVSWYKDGVLLKDDSNLQTSFVHNVATLQILQTNQSHVGQYNCS
ASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKITWAKDN
REIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNVAGKDSCSAHLGVQEPPRFIK
KLEPSRIVKQDEYTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFLDSVAVLEMHSLS
VEDSGDYTCEARNAAGSASSSTSLKVKEPPIFHKKPHPVETLKGADVHLECELQGTPPFQ
VSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCAGSITLK
APPRFVKTLSDISTIVGEEVQLQTAIEGAEPISVVWFKDKGEVVRESDNIWISYSENIAT
LQFSRAEPANAGKYTCQVKNDAGMQECFATLSVLEPAAIVEKPESIQVTTGDTCTLECTV
TGTPELSTKWFKDGKELTSDSKYKISFFNKVSGLKIINVAPGDSGVYSFEVQNPVGKDSC
TASVRVSDRIVAPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQ
TTLTDNTCALTVNLLEESDAGDYTCVATNMAGSDECSAPLTVREPPSFVQKPDAMDVLTG
TNVTFTSIIKGTPPFMVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTMQSGEYTCIV
SNEAGKASCTTHLHVKAPAKFVKRLNDYSIEKGKHLILEGTYTGTPPISVTWKKNGINIA
PSQRCHITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEP
VKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATYKMHFKNNVATLVFNQVDVNDSG
EYICRAENSVGEVSSSTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFECAINGSEPISVS
WYKDGKPLKDGPNVQTSFLDNVATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEG
KNPPFFDIPVAPVDAVVGESADFECHVTGTQPIKVGWAKDNREIRSGGNYQISFLENSAH
LTILKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKKLSETVEETEGNSFRL
EGRVAGSQPITVAWYKNNVEIHPTSNCEITFKNNTLLLQVKRAGMGDAGLYTCKVWNDAG
SALCTSSIVIKEPQKPPVFDQHLTPVTVSEGEFVQLSCHVRGSEPIRIQWLKAGREIKPS
DRCSFSFASGTAVLELKDVTKADSGDYVCKASNVAGSDTSKSKVTVKDKPAAVPAAKKAA
VDGKLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRIFIHQKGDE
AKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPVLKK
GAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQQEETHRLEIEEI
EKSEKEEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLS
WYKGTEKLEPSDKFEISIDGDRHTLRVRNCQLKDQGNYRLVCGPHIASAKLTVIEPAWER
HLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRYKTEVEHKVHKLTIADVRAE
DQGQYTCKYEDLETSAELSIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKG
PTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIK
LEMKPPDIPDSRVPIPTMPIRAVPPDEIPPTAIPPIPLLLPAPEEKKPPAKRVEVTKKAK
KVAKPKEEAPPPKVPEVAKKPPPPTALIPAKAPEIIDVSSKAEEVKIMTITRQKEVQKEK
EAVYEKKRAVYEEKKLFIESLEEPYDELEVEPYTEPYEEPYYEEPDEDYEETKVETRKEV
HEEWEEDFEAGQEYYEREEGYDEGEEEWEETYQEREAVQVQKEVYEEPHERKIPAKVPEK
KEAPPPKVVKKPVVEKIEKTSRRVEEAKVQVTKVPEVSKKIVPQKPSRTPVQEEVIEVKV
PAVHTEKMVISEEKFFASHTEEEVSVTVPKVQKKTVTEEKIQVAVSKKIEPPPKVPEPPR
KPAPEEVLPVPIPKKVEPPPAKVPEVPKKPVPEEKKPVPVPKKEPAAPPKVPEVPKKPVP
EEKVPVPVAKKKEAPPAKVAEVQKRVVTEEKVTIVTQREESPPPAVPEIPKKKVPEEKRP
VPRKEEEAPPPKVPAPPKKPVPEEKVPVPVPVPKKAPPPRAEVSKKAVVEEKRYFAEEKL
SVAVPQRTEVMRHEEEEWSYSEEQERVSISVYREEEREEEEAEVTEYEVMEEPEEYVVEE
ELHVIAERVEAEPAEVPEKKIVPKPKIPAKIEEPSPAKVPEPPKKIVPEKKLPAAVPKKE
KVPPAKVPEEPKKPVPEKRAPPKVAKIEEPVPTKVTERHMQITQEEKVLVAVTKKEEPPR
ARVPEEPKRAIPEEKVPKLKPKKEEEPPTKVAEIRKRAVKEEKVSIEVPKREPQFAKEVA
VAEEKEWSYTREEEVVSVQREEEYEEYEEEYDYKEFEEYEPTEEYEQYDEYEEREFEHYE
EYKEREEYVTEPEKPVPVKPVQEEPVPTKPKAPPVKVPKKAVPEEKVPVPIPKKLKPVPP
KVTEEAKKVVEEKIHISITKREKEQVTEPTAKVPLKLKRVVTEEKVPVPKKEVAAPVRVP
EVPKRREPEEIAFEEEVVTQVEEYHEEEEEYIYEEEELVTEEEVVPVIPVKVPEVPKKPV
PEEKKPVPVPKKKEAPPAKVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVPKKPVPEEKVP
VPVPKKVEAPPAKVPEVPKKPVPEKKVPVPVPKKVEAPPAKVPEVPKKIIPEEKKPTPVP
KKVEAPPPKVPEVPKKVEERPIVVPEEEEVPPVEVFEEPEEPIPEEEIPEEPPTIEEEVE
EVAPPRVPEVVKKAVPEAPTPVPKKVEAPPAKVPKKVPEEKVPVPVQKKEAPPAKVPEVQ
KKVPEKKVPEKKIPEKKVPEKKVLVPKKEAVPPAKDALSGRTVEEKISVAFHKEEVVRER
TEFEIVEAEAVLEEEEFHEVEEYFEEEEFHEVEEFTKVEEHRFEEVHEVEEVHRVIEVLE
AEEVEVYEEPKAPPKGPEISEKVVPPKKPPTKVVPRKEPPAKVPEAPKEVVPEKKVPAPP
PKKPEVPPVKVPEAPKEVVPEKKVPAAPPKKPEVPPAKVPEVPKAAVPEKKVPEAIPPKP
ESPPPEVPEVPPKEVIPEKKVPVAPPKKPEPPPAKVPEAPKEVVPEKKVPVPRPKKPEVP
PVTVPEAPKEVVPEKKVSVAPPKKPEVPPVTVPEAPKEVVPEKKVPVPPPKEPEVPPVKV
PEPPKKVVPEKKVPVAPPKEPEVPPVTVPEAPKEEIIPEKKVPVPPPKKPEVPPVKVPEA
PKEVVPEKKVHVPPPKKPEVPPVKVPEAPKEVVPEKKVPAPPPKKPEVPPVKVPEAPKEV
VPEKKVPAAPPKKPEVPPAKVPEVPKAAVPEKKVPEAIPPKPESPPPEVYEEPEEVVPEE
PPAEVVEEPEPAPPRKVTVPPKKPVPEKKPPAVIAKKPEPPPVKVPEVPKEVVPEKKVPP
VVLKQPEVPPAKVPEVPKEVVPEKKVAVPKKPEVPPPKVPEVPKEPVVEEKPAVPIPEEV
EPPPPEVYEEPEEIAPEEEEPVPVAEEEPEAPPPAVPEEPKKIVPEKKVPVIKKPEAPPP
KEPEPEKKVVEKPKLKPRPPAPAPAPPKEDVKEKIAQLKAVSKKKVPEKPEVPEKVELKP
LKVLGGEKKVRKLLPEPKPQPKEEVVLKSVLRKKPEEEEPKVEPKKVEKVKKPAVPEPPP
KPVEEVEAPPAAVTKREKKVPEPTKVPEIKPPIPLPAPEPKPKPEPEVKIIKPPPVEPAP
TPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVAKKTPSPIELEKKKLRPGSGGEKPP
DEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSPSTAITSWMKDGSNIRES
PKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLIVEELPVRFVKTLEEE
VTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGKIVPGVIGLMRALTINDADDTDAGT
YTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAVFSCHIAKDTPNIKWFKG
YDEIPWEPNDKTEIVKDGNHLYLKIKNATPEDIDEYAVEIEGKRYPAKLTLGDREVELLK
PIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLD
QAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPEKRQARFECVLTREANVIWSKGP
DIIKSSDKFDIITDGKKHILVINNSQFDDEGVYTASVEGKTTSARLFVTGIRLKFISPLE
DQTVKEGETATFVCELSHEKMHVVWFKNDVKLHTSRTVLISSEGKTHKLEMREVTLDDIS
QIKAQVKDLSSTANLKVLEADPYFTVKLHDKTGVEKDEIILKCEVSKDVPVKWFKDGEEI
EPSPKYSIKSDGLRRILKIKKAELKDKGEYVCDCGTDKTTANVNVEARLIKVEKPLRGVE
LFVGETARFEIELSEPDVHGQWKLKGEPLTASPDCEIIEDGKKHILVLYNCQLDMTGEVS
FQAANAKSAAKLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITG
DDKIELIKDGTKHSMVIKSAAFEDEAKYIFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAK
ERESAVFTVELSHDNIRVKWFKNDQRLHTTKLVSMEDEGKIHSITFKNLSIDDTSQIKVE
AMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVVLQCEISKADAPVKWFKDGEEIKPSK
NAIIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLYSVEVMET
ETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKTHFLILHNCRLDQAGGVDFQAA
NVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKV
VTRSEGRVHTLTLRDVKLEDAGEVQLTAKDFKTQAKLFVKEPPVEFTKPLEDQTVEEEAT
AVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDF
KTSCNLNVVPPHVEFLRPLTDLRVKEKEMARFECELSRENAKVHWFKDGAEIKKGKKYDI
ISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVVEEEAVFTKNLTNVDVSETDTIK
LVCEVSKPGAEVTWYKGDEEIIETGRYEILTDGRKRILIIQNAHLEDTGNYNCRLPSSRT
DGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFEVQWKRDDKTLESGDKYDVIA
DGKKRILVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIIVPLKDTRVKEQQEVIFNC
EVNTEGAKAKWFRNDEAIFDSSKYIILQKDLVYTLRIRDARLDDQANYSVSLTNHRGENV
KSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVAFDNRVLY
RIDKYKHSLIIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAV
FSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSVHRLIIKDCRLDDECEYACGVDDRKS
RARLFVEEIPVEIIRPPQDILEAPGTDVVFWAELNKDKVEVQWLKNNMIIVQGDKHQMMS
EGKIHRLQICDIRPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGQPLTMVV
PYDAYPKAEAEWFKENEALSSKTVDTTAEKTSFRILEAKKGDKGRYKIVLQNKHGKAEAF
INLQVIDVPGPVRNLEVTETLDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATD
RADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETANPVEARSRYDVPGPPLNVTITD
VNRFGVSLTWEPPEYDGGAEITNYIIELRDKTSIRWDTAMTVKAEDLSATVTDVVEGQEY
SFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLSSSDQTQSSVQLTWEPPLKDGGS
PILGYIIERCEEGKDEWIRCNKKLVPELTYKVTGLQKGNKYLYRVSAENEAGVSDPSEIL
GPLTADDAFVEPTMDLSSFKDGLEVIVPNPIKILVPSTGYPRPTATWAFGDKVLEAGDRV
KMKTLSAYAELVISPSERPDKGIYTLKLENRVKAISGEIDVNVIARPSAPKELKFDDITR
DSVHLTWEPPDDDGGSPLTGYLVEKREVNRKTWTKVIDSVTDLEFTVPDLVQGKEYLFKV
CARNKCGPGEPAYVDEPVNMSAPATVPDPPENVKWRDRTAKSIFLTWDPPKYDGGSRIKG
YIVEKCPRGSDRWVACGEPVAETKMEVTGLDEGQWYSYRVKALNRQGASKPSKPTDEIQA
VDAQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPTITWTKADMLLKQDKRITIEN
VPKKSTVTIVDSKRSDTGRYIIEAVNVCGRATAVAEVNVLDKPGPPAAFDITEVTNESCL
LTWNPPRDDGGSKITNYVVERRAADSDMWHKLSSTVKDTKFKATNLIPNKEYLFRVAAEN
MYGVGEPVQATPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVER
LDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPI
DPPWPPGKPTVKDIGKTSIMLNWTKPEHDGGAKIESYVIEMLKTGTEDWVRVAEGVPTTQ
HLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTAD
LKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAEN
AIGQSDYCEVEDSVLAKDTFTTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQRYVIE
KKEKLGTRWVKAGKTSGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDP
TSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKD
LKFKVEEGVVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCKPTIDLETHDIVVIEG
EKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKSDHISAHLEVPKSVHADAGVYTITL
ENKLGSATGSINVKVIGLPGPCKDIKASDVTKSSCKLTWEPPEYDGGSPILHYVLERREA
GRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPD
PPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPVLTYTA
KGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRSSLEVRRGDEIALDA
TISGSPYPTITWIKDEEIITPEEIKKRVAPMVRRRRGEVQEEEPFVLSLTERLSIDNSKK
GESQLRVRDSIRPDHGQYMIKAENDHGIAKAPCTVSVLDTPGPPINFVFEDVRKNSVVCK
WEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYPVTKLIEGKEYLFRVRAEN
RFGPGPPCVSKPLIAKDPFEPPDAPDKPIVEDVTSNSMLVTWNEPKDNGSPILGYWLEKR
EVNSTHWSRVNRNLLNSLKTNVEGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPIA
PPGPPVPRVADTSSTTIELEWEPPAFNGGGEIIGYFVDKQLVGTNEWSRCTEKMIKARQY
TVREIREGADYKLRVSAVNAAGEGPPGETEPVTVAEPKEPPTVELDVSVKAGIQIMAGKT
LRIPAVVTGRPVPTRVWTIEEGELDKDRVVIENVGTKSELIIKNALRKDHGRYVITATNS
CGSKFAATRVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSDITGFIIERKDAKMH
TWRQPIETDRSKCDITGLLEGQEYMFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERL
TYTERTKSTITLDWKEPRNNGGSPIQGYIIEKRRHDKPDFERVNTRLCPTTSFLVENLDE
HQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLAVRGDTIKVKAGEPVNIPAD
VTGLPMPKIEWSKNETVIEKPTDALKITKEEVSRSEAKTELSIPKAVRADKGTYTVTASN
RLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASR
KKSEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDDCKSDKVVIQDPYRPPGP
PGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGAYWSRVSRAPITKTGLKGV
EFNVPRLIEGVKYQFRAMAINAAGVGPPSEPSDPAVAGDPIYPPGPPSCPEVKDKTKSSI
SLAWKPPAKDGGSPIKGYIVEMQEEGTTDWKKVNEPDKLLTTCECVVPNLKELRKYRFRV
KAVNEAGESEPSDTTGEIPATDILEVPEVFIDIGAQDCLICKAGSQIRIPAVIKGRPTPK
SSWEFDGKAKKALKDGVHDIPEDAQLETAENSSVIIIPECKRSHSGKYSITAKNKAGQKT
ANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKV
NPNCGSTTFVIPDLISEQQYFFRVRAENRFGIGAPVETIQRTTARDPIYPPDPPIKLKIG
LITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWKQCNKRDVEELEFTVEDL
VEGGEYEFRVKAVNAAGVSKPSETVGPVIVKDQTCPPSIELKEFMEVEEGTDVNIVAKIK
GVPFPTLTWFKAPPKKPDNKEPVVYDTHVNKVVVDDTCTLVIPQSRRSDTGLYTITAVNN
LGTASKEMRLNVLGRPGPPVGPIKFESISADQMTISWLPPKDDGGSKITNYVIEKREPNR
KTWVHVTSEPTECMHTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPD
KPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYK
VTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTARDPIAPPGPPFPKVTDWTKSTADLEW
SPPLKDGGSRVTGYIVEYKEEGKEEWEKAKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIA
GIGEPGEVTDAIEMKDRLVLPDVQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTITWNMN
ERALPQEANIETTAISSSMVIKNCQRSHQGVYSLLAKNAAGERKKTIIVDVLDVPGPVGI
PFLPHNLTNDSCKLTWFSPEDDGGSPITNYVIEKREADRKAWTPVTCTVTRQNATVQGLI
QGKAYFFRIAAENSIGMGPFVETTEELVIRDPITVPERPEDLEVKEVTKDSVTLTWNPPK
YDGGSEIINYVLESRLIGTEKFHKVTSDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGK
PSFCTKPITCKDELAPPTLDLDFRDKLTIRVGEAFALTGRYSGKPKPKVTWFKDEADVLE
DDRTQIKTTPTTLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVIF
DEVTKDHMIISWKPPLDDGGSEITNYIIEKKEVGKDVWMPVTSACAKTTCKVPKLLEGKD
YIFRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPNDGGKP
ITNYILEKRETMTKRWVRVTKEPIHPYTKFRVPDLLEGCYYEFRVSAENEIGIGDPSPPS
KPVCAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWKR
ANHTPESCPETKYKVTGLRDGQSYKFRIRAVNEAGESDPAHVPEPVLVKDRLEPPELILD
ANMAREQHIRVGDTLRLSAVIKGVPFPKVTWKKEDREAPTKARIDVTPVGSKLEIRNAAH
EDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVV
TNYVVERRDVASAQWSPLSTTSKKKSHLAKHLNEGSQYLFRVAAENQYGRGPFVETPKPI
KAVDPLHPPGPPKNLHHVDVDKNEVSLVWNKPDRDGGSPITGYLVEYQEEGTEDWIKFKT
VTNLECVVTGLQQGKTYKFRVKAENIVGLSLPDTTIPIECQEKLVPPSVELDVKLIEGLV
VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDDHYTVETDSYSSVLTIKNCLRKDTGEY
QITVSNAAGSKTVAVHLTVLDVPGPPTGPINILEVTPEHMTISWQPPKDDGGSPVINYIV
EKKDTRKDTWGVVSSGSSKTKLKVPHLQKGFEYVFRVRAENKMGVGPPLDSVPTVAKHKF
SPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTPITELK
YTVTGLYDGNTYEFRVFAENLAGLSSPSPSSDPIKACRPIKPPGPPINPKLKDKTRETAD
LVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKA
ANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDIT
WSKEGKALVREKRVDIIHDLPRAELQIKEAIRADHGKYIISAKNSSGHAQGSTIVNVLDR
PGPCQNLRVSNVTKENCTIAWENPLDNGGSEITNFIVEYRKPNEKGWSIVASDVTKRLIK
ANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKW
RRPDYDGGSPNLSYHVERRLKGSADWERVHKGSIKETHYMVDKCVENQIYEFRVQTKNEG
GESDWVKTEEVVVKEDLQKPVLELKLSGVLTVKAGDTIRLEAGVRGKPFPEVLWTKDKDA
TDLTRSPRVKIDTSADSSRFSLTKAKRSDGGKYVITATNTAGSFVAYATVNVLDKPGPVR
NLKITDVSSDRCTICWDPPEDDGGCEIQNYILEKCESKRMVWSTYSATVLTTGATVTRLI
EGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWTPPEY
DGGKSITGYFLEKKEKHGTRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEIGIGEP
SLPSKPVVAKDPIEPPGPPTNLKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKRPD
MSPDEGWKRCNAAAQLVRMEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKDAIKPKEIL
EPPEIDLDASMRKLVTVRAGCPIRLFAIIRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMA
FLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHISWGP
PENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTSFQVTNLVPGNEYFFRVTAVNEYGPG
VPTDVPKPVLASDPLCEPDPPRKLEVTEMTKNSAALAWLPPLRDGGAKIDGYIISYREEE
QPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVVARNAVGVSLPRETEGVYEAKEQLLPPK
ILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADNSSILIIKDV
TRKDSGYYSLTAENSSGTDTQKIKVIVMDAPGPPQPPFDISDIDADACTLSWHIPLEDGG
SSITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSP
KMLAKFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKA
NDTPVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDV
TKNTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTTPHQIPQEEYTVTGLEENAQ
YQFRAIAKTAVNISQPSEPSDPVTIVAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFG
KPMPTVSWKKEGTLLQPAEGIKMAMKRNLCTLELFSVNRKDSGDYTITAENSSGSKSATI
KLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSAT
VPITSCSVEKLIEGHEYQFRICAENKYGVGDPIFTEPAVAKNPYDPPGRCDPPVISNITK
DHMTVSWKPPADDGGSPITGYLVEKRETQAVNWTKVNRKPVIERTIKATGLQEGTEYEFR
VTAINKAGPGKPSDASKAVYAQDPLYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPII
GYLVEVKRADSDNWVRCNLPQKLQKTRFEVTGLLENTEYQFRVYAVNKIGYSDPSDVPDK
HCPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGLD
IKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKD
SAYITWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVF
AENEYGIGDPGETRDAVKASETPGPVVDLKVTSVTKSSCSIGWKKPRSDGGSRIIGYVVD
FLTEENKWQRVMKSASLQYSTKDLTEGKEYTFRVSAENENGEGTPSEITAVAKDDVVAPD
LDLKDLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLV
VYDCQKSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFEEVTAEAITLKWGPPK
DDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEG
LKSEPIVAKHPFDVPDAPPPPNIVDVRHDSVSLTWTDPRKTGGSPITGYHIEFKERNSLL
WKRANKTPIRMKDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPE
VINVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWTKANHVNVPDCAFTVTDLVEG
GKYEFRIRAKNTAGAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLSAI
SILGKPLPKSSWSRAGKDIRPSDIVQISSTPTSSMLTVKYATRKDAGEYTITATNPFGTK
EEHVKVIVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTV
VAEDIQSCRHVATKLIQGNEYIFRVSAVNQYGKGEPVQSEPVKMVDRFGPPGPPGKPEIS
NVTKNTATVSWKRPTDDGGSEITGYHVERREKKSLRWVRATKTPVSDLRCKVTGLQEGNT
YEFRVSAENKAGVGPPSDASNPVLMKDVAYPPGPPSNARVTDTTKKSASLAWGKPHYDGG
LEITGYVVEHQKVGDEAWIKDTTGTALRITEFVVPDLQTKEKYNFRISAINDAGVGEPAV
IPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDDINLKNRA
NIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLKPTDITK
DSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTVTTKCHKCTYKVTGLSEGCEYFFRV
MAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSRITGYVI
EAQRKGSDQWTHITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTM
LPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFENTATST
ILNINECVRSDSGPYPLTAKNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWD
PPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGMEYQFRVKAQNRYGV
GPGITSASIVANYPFKVPGPPGTPQVTAVTKDSITISWHEPLSDGGSPILGYHIERKERN
GILWETVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPAFALDPIDPPG
KPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGL
TEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDIEAPRIMVDVKFKDTVILKAGEAFKL
EADVSGRPPPTMTWTKDGKELEGTAKLEIKIADFSTNLVNKDSSRRDGGAYTLTATNPGG
FAKHIFNVKVLDRPGPPEGPLAVSEVTSEKCVLSWLPPLDDGGAKIEHYVVQKRETSRLA
WTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVDPFGRPDPPKNP
EVTAITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKRTLTDLRYKVSGLTE
GHEYEFRIMAENAAGISAPSPTSPFYKACDTVYKPGPPGNPRVLDTSRSSISIAWNKPIY
DGGSEITGYMVEIALPEEDEWKIVTPPAGLKATSYTITNLTENQEYKIRIYAMNSEGIGE
PALVPGTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWTREHGES
LDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVK
EVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSY
YFRVLAENEYGIGLPAETAESVKASERPLPPGKITLVDVTRNSVSLSWEKPEHDGGSRIL
GYIVEMQSKGSDKWVTCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIA
KDLVIPPAFKLLFNTFTVLAGEDLKVDVPFVGRPTPAVTWHKDDVPLKQTTRVNAESTEN
NSLLTIKEACREDVGHYTVKLTNSAGEATETLNIIVLDKPGPPTGPVKMDEVTADSITLS
WGPPKYDGGSSINNYIVEKRDTSTTVWQIVSATVARTTIKASRLKTGCEYQFRIAAENRY
GKSTYLTSEPIVAQYPFKVPGPPGTPFVTLSSKDSMEVQWNEPVSDGGSKVIGYHLERKE
RNSILWVKLNKTPIPHTRFKTTGLDEGIEYEFRVSAENIVGIGQPSKVSECYVARDPCDP
PGRPEAIMVTRNSVTLQWKKPTYDGGSKITGYVVEKKELPDGRWMKASFTNVIDTQFEVT
GLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGELF
RIDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRIDSGNYILKAKNV
AGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSR
LVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVMAKNPFVVPDAPK
APEITTVTKDSMIVVWERPASDGGSDILGYVLEKRDKEGVRWTRCHKRLIGELRLRVTGL
LENHNYEFRVSAENAAGLSEPSLPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKP
IYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAVNKAGV
GEHADVPGPVIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKMDG
EIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLK
VTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGC
SYYFRVTAENEFGIGLPAHTADPVKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSK
IIQYIVEMQAKHSEKWSECARVKSLEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPI
VAKDLVIEPDVRPAFHSYSVQVGQDLKIEVPISGRPKPTVTWTKDDLPLKQTTRINVTDS
LDLTVLSIKETHKDDGGHYGITVANVVGQKTASIEIITLDKPDPPKGPVKFDEVSSESIT
LSWNPPLYTGGCQITNYIVQKRDTTTTVWDTVSATVARTTLKVTKLKTGTEYQFRIFAEN
RYGQSFALESDPIVAQYPYKEPGPPGTPFVTTTSKDSMVVQWHEPINNGGSPVIGYHLEK
KERNSILWTKVNKSIIHDTQFKAVNLEEGIEYEFRVYAENIVGVGKVSKNSECYVARDPC
DPPGTPEAIMVKRNEITLQWTKPAYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFT
VSGLTEDQRYEFRVIAKNAAGTISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGE
TFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRAS
NVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCNLTWSPPLQDGGSDISHYVVEKRET
SRLAWTVVASEVVTNSLKITKLLEGNEYIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGP
PKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVT
GLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPINAHVVDTTKNSITLTWG
KPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLKATRFEISKLTEHQEYKIRVCALNKV
GLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPDITWSRE
EGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQN
LAVKEVKKDSVILVWEPPMIDGGAKVKNYVIDKRESTRKAYANVSNKCSKTSLKVENLTE
GAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGG
SRILGYVVEMQPKGTEKWSVVAESKVCNAVITGLSSGQEYHFRVKAYNEKGRSDPRVLGV
PVIAKDLTIPPSFKLPFNTYSVQAGEDLKIEIPVIGRPRPEISWVKDGEPLKQTTRVNVE
ETANSTILHIKETNKDDFGKYTITATNIAGTATENLSIIVLEKPGPPVGPVRFDEVSADF
VVISWEPPAYTGGCQISNYIVEKRDTTTTTWQTVSATVARTTIKIAKLKTGTEYQFRIFA
ENRYGKSTHLDSKPVIVQYPFKEPGPPGTPFVTSVSKDQMLVQWHEPVNDGGSKVIGYHL
EQKEKNSILWIKLNKTPIPDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKVSECFVARD
PCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETE
FTVSGLVEDQRYEFRVIARNAAGNFSEPSESTGAITARDEIDAPNASLDPKYKDVIVVHA
GETFVLEADIRGKPIPDIVWLKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYIL
KLSNVGGTKSIPITVKVLDRPGPPEGPLKVSGVTAEKCYLAWNPPLQDGGANISHYIIEK
RETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGVGEPLESEPVIARNPYKP
PGPPSPPEVSAITKDSMVVTWARPVDDGGAEIEGYILEKRDKEGVRWTKCNKKTLTDLRF
RVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSL
AWNKPIYDGGAPVKGYIVEVKEATADEWTTCTPPTGLQGKQFTVTNLKENTEYNFRICAI
NSEGVGEPATIPGSVVAKDRLEPPEIELDADLRKMVVLRASATLRLFVTIKGRPEPEVKW
EKAEGILTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSA
PVNLSVKDVKKDSVTLSWEPPLIDGGAKVTNYIVEKRETTRKAYATVTNNCTKTTFKIEN
LQEGCSYYFRVLACNEYGIGLPAETSEPVKASEPPLPPGRVTLVDVTSNTATIKWEKPES
DGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTSGEEYIFRVAAVNEKGRSDPRQ
LGVPVIARDIEIKPSVELPFHTFNVKARDQLKIDVPYKGRPQATVSWKKDGQTLRETTRV
NVSSSKTVTSLSIKEASREDVGTYELSVSNSAGSITVPITVIVLDRPGPPGPIHIDEVSC
DNITISWNPPEYDGGCQISNYIVEKRETTSTTWHVVSQAVARTSIKIVRLTTGSEYQFRV
CAENRYGKSTYSDSPAVVAEYPFSPPGPPGTPKVVHATKSTMIVTWQVPVNDGGSQVIGY
HLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPA
RDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIIERRELPDGRWLKCNFTNVQE
TYFEVTELTEDQRYEFRVFAKNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIVV
KAGEVLKINADIAGRPLPVISWAKDGVEIEERARTEIVSTDYNTLLTVKDCVRRDTGQYI
LTLKNVAGTRSVAVNCKVLDKPGPPAGPLEIYGLTAEKCSLSWGPPQENGGADIDYYIVE
KRETSRLAWTICEGELRTTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAVKALDPFT
VPSPPTSLEITSVTKDSMTLCWSRPESDGGSEISGYIIERREKNSVRWVRVNKKPVYDLR
VKSTGLREGCEYEYQVYAENAAGLSLPSETSPLIRAEDPVFLPSPPAKPKIVDSGKTNIT
ISWVKPLFDGGAPVTGYTVEYKTSDETDWKTAIQNLRGTEYTISGLTTGAEYVFRVRSIN
KVGASDPSDSSDPQIAKEREEEPVFDLDSEMKKTLIVKAGASFTMTVPFRGRPVPNVSWS
KPDTDLRTRAYIDSTDSRTSLTIENANRNDSGKYTLTIQNILSAASLTLVVKVLDSPGPP
ANISVHDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNL
QEGAIYYFRVSGENEFGVGVPAETKDGVKITEKPSPPEKLGVTSVSKDSVSLTWLKPEHD
GGSRIVHYVVEALEKGHKNWFKCAVVKSTHHVVSGLRENSEYFFRVFAENQAGLSDPREL
LLPVLIKEQLEPPEIDMKNFPSQTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATM
RFNTEITAENLTINLKESVAADAGRYEITAANSSGTTKTFINIIVLDRPGPPTGPVVISD
ITEESVTLKWEPPKYDGGSQVTNYIVLKRETSTAVWTEVSATVARTTIKVMKLTRGEEYQ
FRIKAENRFGISDHIDSACVVVKLPYTTPGPPSTPWVTNVTQESITVSWHEPVSNGGSAV
IGYHLEMKDRNSILWQKVNKMIIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHASEP
VLAIDACEPPRNIRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTN
VIETQFIVSGLTQNSQYEFRVFARNAIGSISNPSEVVGPVTCIDSYGGPVIDLPLEYTEV
VKYRAGTSVKLRAGISGKPEPTIEWFKDDKELQTNALLCVENTTDLASILIKDANRLNSG
RYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPVDDGGAKITHY
VVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYVFRVRAVNKYGIGDPLESDPVVAKN
AFVTPGPPSIPEVTKITKNSMTVVWNRPVADGGSEISGYFLEKRDKKSLGWFKVLKETIR
DTRQKVAGLTENSDYQYRVCAVNAAGQGPFSEPSDFYKAADPIDPPGPPAKIRIADSTKS
SITLGWSKPVYDGGSAVTGYVVAMRQGEEEEWTVVSTKGEVRTTEYVVSNLKPGVNYYFQ
VSAVNCAGQGEPIEMTEPVQAKDILEEPEIDLDVALRTSIIAKAGEDVHVFIPFKGRPPP
TVTWRKDEKNLGSDARYSIQNTDSSSLLIIPQVTRNDTGKYILTIENGVGQPKSSTVSVK
VLDTPAACQKLQIKHVSQGTVTLFWDPPLIDGGSPIINYIIEKRDATKRTWSSVSHKCSS
TTFKVKDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSVKDSTKTSVTL
SWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVGQLKELSELEFRVSAKNEK
GLSDAVTIGPVTVKELVITPEVDLSEIPGAQVAVRIGHNVHLELPYKGKPKPSISWLKDG
LPLKESEYVRFSKTENKITLSIKNVKKENGGKYTVILDNAVCRTSVPITIITLGPPSKPK
GPVRFDEIKADSVIMSWDVPDDDGGGEITCYSIEKREASQKNWKMVCSSVARTTFKVPNL
VKDAEYQFRVRAENRYGVSQPLVSTIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPV
YDGGAEVTGFHVEKKERNSILWQRINTSPISGREYRATGLMEGLDYQFRVYAENSAGLSA
PSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWV
RCNFTDVSECQYTVTGLSPGDRFEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFG
PEYFDGLTIKSGESLRIKALVQGRPVPRVTWFRDGVEIEKKMNMEITDVLGSTSLFVRDA
TRDHRGVYTVEAKNVSGTAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGC
APITHYIIEKRETSRLAWALIEDNCETLSYTAVKLITGNEYQFRISAVNKFGVGRPLDSD
PVVAQIQYTIPDAPGTPEPSNVTGNSITLTWARPESDGGNEIQQYILERREKKSTRWVKV
ISKRPISETRFKVTGLTEGNEYEFHVMAENDAGVGPPSGISRLIKCREPVNPPSAPTVVK
VTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAG
EEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAY
QGRPTPTAVWTKPDSNLSIRADIHTTESFSTLTVENCNRNDAGKYTLTVENNSGSKSVTF
TVKVLDSPGPPGPITFKDVTRGSVTLMWDAPLLDGGARIHHYVVEKREASRRSWQVVSEK
CIRQILKVNDLVEGVPYYFRVSAENEYGVGEPYEMPEPMVATEQPAPPKRLDVVDTSKSS
AVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHTKQLTFTVERLVENTEYEFRVKAK
NDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTW
KLEEMRLKETDRVSITTTKDRTTLSVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRP
GPVTGPIEVSSVSAESCVLSWAEPKDDGGTDITNYIVEKRESGTTAWQLVNSSVKRTQIK
VTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYYVSANAMSIRW
EEPYHDGGSKVIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAA
GVSKASEASRPMMAQNPVDAPGRPEVTDVTRSTVSLIWSSPVYDGGSKIVGYIIERKPVS
EVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEY
APPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKISLQYTGK
RATAVIKFCDRSDSGKYTLTVKNASGTKAVSVLVKVLDSPGPCGKLTVSRVTEEKCTLAW
SLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYG
PGVPVESEPIVARNSFTIPSQPGMPEEVGAGKEHIIIQWVKPESDGGNDISNYLVDKREK
KSLRWTRVNKDYVVYDTRLKVTGLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYT
PGPPSAPRVVDTTKHSISLAWTKPMYDGGVDITGYVLEMQEKGTDQWYRVHTNATIRNTE
FTVLDLKMGQKYSFRVAAVNVKGMSEYSESTAEIEPVERLEIPDLELADDLKKTVTLRAG
ASLRLMVSVSGRPPPVITWSKKGIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAEN
QSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAM
RAFKTVTTKCSKTLYRISGLVEGCMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKL
EVVDVTKSTVSLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVATLKPTVLEHTVISLNE
GEQYLFRVRAQNEKGVSEPREIVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIP
IAGRPPPAASWFFAGSKLRESDRVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTS
ETIKVIILDKPGPPTGPIKIDEIEATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLP
VSESVTRQTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSISIPGPPETLQIF
DVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLE
YEHRVTAINARGTGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGG
SKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEV
PGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRA
MIATSETHTELVIKEADRDDSGTYDLVLENKCGKKAVYIKVRVIGNPNTPEGPLEYDDIQ
ARSVRVSWRPPADDGGADILGYILERREVPKSAWYTIDSRVRGTSLVVKGLKENVEYHFR
VSAENQFGISKPLKSEEPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRV
TGYYIERRETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEP
VVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSN
KDRIKDRQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTSGEAPGVRKELKD
VTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEG
VYTCMATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAIT
WFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNIFGTVDAILDVEIQD
KPDKPTGPIVIEALLKNSVVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVT
TCRIVNLTENAGYYFRVSAQNTFGISDPLEVPSVVIIKSPFEKPSAPGKPMITAVTKDSC
VVAWKPPASDGGAKIRNYYLEKREKKQNKWIAVTTDEIRETVFSVQNLIEGLEYEFRVKC
ENLGGESEWSEISEPVTPRSDVPIQAPHFKEELRNLHVRYQSNATLVCKVTGHPKPIVKW
YRQGKEIIADGLKYRIQEFKGGYHQLIIAAVTDDDATVYQVRATNQGGSVSGTASLEVEV
PAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRS
FTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLT
WTEPASDGGSKITNYIVEKCATTAERWIRVGQARETRYTVINLFGKTSYQFRVIAENKFG
LSKPSEPSEPTITKEDKTRAMNYDEEVDETREVSMTKASHSSTKELYEKYMIAEDLGRGQ
FGIVHRCVETSSKKTYMAKFVKVKGTDQVLVKKEISILNIARHRNILYLHESFESMEELV
MIFEFISGLDIFERINTSAFELNEREIVSYVRQVCEALEFLHSHNIGHFDIRPDNIIYQT
RRSSVIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHHHDLVSTATDMWSLGTLVYVLL
SGTNPFLAETNQQIIENIMNAEFTFDEEAFREISLEAMDFVDRLLVKERKSRMTASEALQ
HPWLKQKTEKVSTKVIRTLKHRRYYHTLIKKDLNMVVSAARISCGGAIRSQKGVSVAKVK
VASIEIGPVSGQIMHAVGEEGGYVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYED
GVATMYVKHITKFDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTD
TMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPDDDDKKYTF
ESDKGLYQLTISSVTLEDDAEYTVVARNKYGEDSCKAKLTVTPHPPPTDTTLRPMFKRLL
ANAECQEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPE
DTGYYRVTATNTAGSTSCQAHLQVERLRYVKHEYKSKEERERHVQRQIDKTLRMAEILSG
TESVPLTQVAQEALREAAILYKPAISTKTVKGEFRLETEEKKEERKLRMPYEVPEPRKYK
QTTIEEDQHIKQFVPMSDMKWYKKIRDQFEMPGKLDRVVQKRPKRIRLSRWEQFYVMPLP
RFTDQYRPRWRIPKLSQDDLEMVRPARRRTPSPDYYFYYRPRRRSLGDISDEELLLPIDD
YLAMKRTEEERLRLEEELELGFSASPPSRSPPRFELSSLRYSSPQAHVRTEETRKDFRYS
TYHIPVKAETSTSYAELHERHARASYRQPKQRQRIMAEKEDEELLRPVTTTQRLSAYKSE
LDHISKEEKSRKKSRQQREVTEITEIEEEYEISKHAQRETSSSVSRLLRRRRSLSPTYIE
LMRPVSELIRRRPQPAEEYEDEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARF
DIFSRYESMKAALKTQKTSERKYEVLTQQPFTLDHAPRITLRMRSHRVPCGQNTCFILNV
QSKPTAEVKWYHNGVELQESSKIRYTNMSGVLTLEILDCHIDDSGTYRAVCTNYKGEASD
YATLDVTGGDYTTYASQRRDEDVPRSVFPELTRIEAYAVSSFKKTSEMEASSSVREMKSQ
MTETRESLSSYEHHASAEMKSAAIEEKSLEEKSTHRKIKTTLAARILTKPRSITVYEGES
ARFSCDTDGEPVPTVTWLRGGQVISTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVEN
SDGKQAAQFTLTIQKARVTEKAVTAPPRVKSPEPRVKSPEGVKSPKRVKSPEPVTSHPKA
VSPTETKPTPTEKLQQLPVSAPPRITQSLKAEASKDIAKLTCAVESSILSAKEVTWYKDG
KKLRENGHFQFHYSADGTYELKIHNLTESDCGEYVCEISGEGGSSKTNFQFTGQAFKSIH
EQVSSIAETKKSAQKTAESTETKKSVQKTAESTETKKTAQKTTESTETKKTAQKTAESTE
TKKTEPKAPEPISSKPVIVTGLQDTTVSSDSTAKFAVKVTGEPRPAVIWTKDGKAITQGG
KYKLSEDKGGFLLEIHKTETSDGGLYTCTITNSAGSVSSSCKLTIKAVKDTEAQKVSTQK
TSEITSQEKAVVQEEISQKALISQEIKKSEVKSQEKLAMKEEASKVLISEKVKKSEAASL
DKSIVHEEISKTSQASEEIRTQAEVKAFSTQMSINDGQKVTLKANIAGATDVKWVLNGVE
LTNSEEYRYGVSGSDQTLTIKQAGHKDAGILTCIGKTSQGIVKCQYDLTLSKELSDAPAF
ISQPRSQNVNEGQNVLFSCEISGEPSPEIEWFKNNLPISISSNISVSRSRNVYSLEIRNA
SESDSGKYTVKAKNFRGQCSATASLTVLPLVEEPSREVVLRTSGDTSLHGSFSSQSMQMS
ASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGKASMTQLESST
SRMLKAGIRGVPPKIEALPSDISIDEGKVLTVACAFTGEPTPEITWSCRGRKIKNQEQQG
RFLIENTDDLTTLIIMDVQKQDGGIYTLSLGNEFGSDSATVNINIRSI
NT seq 100407 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcaagcaccgacgtttacgcagccgttacagagcgttgtggtactggagggt
agtaccgcaaccttcgaggctcacgttagtggtttgccagttcctgaggtgagctggttt
agggatggccaggcaatttccacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctagactgacgatccccgccgtgactaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgacagccgag
acagcgccacccaacttcgttcaacggctgcagagcatgactgtgagacaaggaagccaa
gtgcgactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggac
ggagccgaaatccagagctcccttgatttccaaatttcacaagaaggcgaactctacagc
ttactgattgcggaagcatacccggaagactccgggacctattcagtaaatgccaccaac
agcgttggaagagctacttcgactgccgaattgctggttcaaggtgaagaagtagtaccc
gctaaaaagacaaagacaattgtttcgactgctcagatttcagaaacaagacaaacccgg
attgaaaagaagattgaagcccactttgatgccagatcaatcgcaacagttgagatggtc
gtagatgggcaacagctgccacataaaacacctcccaggatacctccgaagccaaagtca
aggtctcccacaccaccatccattgctgccaaagcacagttggctcgacagcagtcccca
tcgccgataagacactcgccttcccccgtcagacatgtgcgagcaccgaccccatctccg
gtcaggtccgtgtctccggctgggaggatctccacgtcgcccatcagatctgtgaagtcg
ccattgctcgtccgtaagactcagacctccaccctggcccaaggccctgaagtgcctcct
ccttggaagcaagagggctatgtggcctcatctgaggctgagatgagagaaacgacggtg
acaagcgcgactcagatcaggacagaggagagatgggaagggagatacggagtccaggag
gaagtgaccatcagcggagctgcgggcgctgctgccagcgtgtcggtgagcgctgccttc
gcggcaggtgctgtcgccacgggtgctgcagaggtgaaacaagaaactgacaaaagtgca
gctgttgcgaccgttgttgctgctgttgatatggccagagtgagagaaccagttatcagt
gctgtagagcagactgctcagaggacaaccacgactgccacacacatccaacctgctcaa
gaacagataagaaaggaggcagagaagactgctgtaactaaggtagtagtggccgccgat
aaagcgaaggaacaagaattaaaaagaaccagagaagtaattacgacaaaacaagagcag
gtgcgcgtaactcacgaacagataagaaaagaaactgaaaaagcatttgtaccaaaagta
gtaatttctgcagctaaagccaaagaacaagaaactagaattactggagaaattactaaa
aaacaagaacaaaaacaaataactcaagaaacgataatgaaagaaactaggaaaacagtg
gtacctaaagtcatagttgccacacccaaagtgaaagaacaagatttagtatcaagaact
agagaaggcatcactaccaaaagagagcaagttgaaataactcaggaaaagatgagaaag
gaagctgagaaaactgccttgtctacaatagcagttgcaactactaaagccaaagaacaa
gaaacaatactgagaactagagaagcaaaggctactagacaagaacaaatccaagttacc
caagaaaaggtggacgttgggaaaaaggctgaagctgtagcaacagttgttgctgcagta
gaccaggcccgtgttagagagcccagagcacccgcgcatcttgaagaatcgtatgctcag
cagactactttggaatatggatacaaggagcacatttctgccacaaaggtagctgagcat
ccccagcgtccggcctcagaaccccacgttgtccctaaagcagtcaagcctagagtaatc
caggttccttctgagactcatgtcacaactactgatcaaatgggaatgcagatatcatca
cagatcaagaaaactacagatctaacaactgaaagattagtccatgtggataaacgcccc
cgcacagcaagccctcactttaccgtttcaaagatttctgttcctaagacagatcatgga
tatgaggcatcaatagccggtactgctattgccacattacaaaaagagttgtcagccaca
tctcctgctcagaagatcaccaaatcagtgaaggcacccacggtgaagcctgctgagacc
agagtgagagcagagcccaccccctcgcctcagttcccctttgctgacataccagagact
tacaagagtcaagctggcattgaagtgaaaaaggaagtaggggtgagcatcgctggtgcc
accgtccgtgaagagcactttgaagtactgcacggacgtgaagtcaaggtaacagaagca
gcaagagtgcctgcacctgttgaaattcctgttactccaccaactttggtctcgggctta
aaaaatgtgactgtcatagaaggtgaatctgtcaccttggagtgccatatatctggatac
ccatccccaaaagtgacgtggtacagagaagactaccaaatagaaagttccattgacttc
cagataaccttccagagcggaattgctcgtctgatgatccgagaagcctttgcagaagac
agcgggcggtttacttgcagtgctgtgaacgaggctgggaccgtcagcacatcctgctat
ctagctgtgcaggcatcagaagagtttgaaaaggaaacaacagctgtggctgagaaagtt
accacagaagagaaacgctttgtggaatcaagagatgtggtaatgactgataccagcatc
acagaggaaatagccggacccggagaacctgccgctcctttctttattacaaaaccagtg
gtccagaaactggtggaaggtgggagcattgtgtttgaatgccaagttggcggcaaccca
aagccccatgtctactggaaaaaatctggggttcctctaaccagtggatacagatacaaa
gtgagttacaataaacaaaccggtgagtgcagactggtgatttcgatgacttttgctgat
gatgctggagaatacacgattgttattcgtaacaagcatggagaaacttctgcatctgcc
tccttgctcgaagaagctgaatatgagtcactggtgaagtcccagcaagaaatgctttac
cagacacaaatgactgcattcgtgcaagaacctaaagttggagaaatagcacctggattt
ctatactctgagtatgaaaaagaatatgaaaaagaacaggccttaattaggaagaaaatg
gccaaagatactgtaatggtcagaacttttgtagaagaccaggaattccacatttcttcc
tttgaagagagactcattaaagaaattgaatacagaataataaagactacattagaagaa
cttcttgaagaagatggagaagaaaaaatggcagtggacatttctgaatctgaagccatt
gaatcaggatttgaattacgagtcaagaattatagaattcttgaggggatgggtgttaca
tttcattgcaagatgtctgggtatccgctacccaagattgcatggtacaaagatggcaag
cgcatcaaacatggagagagataccaaatggactttctacaagatggcagagccagtctg
cgcatacccgttgttcttccagaagatgaaggcatctatactgcatttgccagcaatatt
aaaggaaatgcgatttgctcagggaaattgtatgtggagcctgctgcaccacttggtgct
ccgacttacatacccacaccagagccagtgagcagaatcagatctgtctctccacgttca
gtgagcagatctcctatacgcatatctcctgcacggatgtcccctgcaaggatgtctcct
gcacggatgtcccctgcaagaatgtcccccggacgtaggctggaggaaacagatgagtca
caacttgagagactgtataagccagtcttcgtgttaaaacctgcttctttcaaatgttta
gaaggacaaactgccagatttgacttgaaggttgtgggtagacctatgccagagaccttc
tggtttcatgatggccagcaaattgtcaatgactacacccataaagtagtcattaaagaa
gatggcacccaatcactgattattgtccctgcagcacccagtgattctggggaatggact
gtggttgcccaaaacagggcaggcagatcttcaatttcagtaatgttaactgtggaagct
gtggaacatcaggtaaaaccagtgtttgtggaaaaactgaaaaatgtcaatgtaaaggaa
ggttctcgacttgaaatgaaagtcagagctacgggtaatcccaaccctgacattgtatgg
ttgaaaaacagtgacatcattgtacctcataaatatccaaaaatcagaattgaaggaacc
aagggagaagcggcccttaaaatcgattctactgtcagccaagattctgcctggtatact
gccactgctattaataaggctggccgagacactacaagatgcaaagtcaatgttgaagtt
gagtttgcagagcccgaaccggaaagaagattaatcatcccaagaggaacatacagagca
aaggagattgcagcccctgaactggagcccctccatttgcgatatggtcaagaacaatgg
gaagagggtgacctctatgacaaagagaaacaacagaagccatttttcaagaaaaaactc
acttccttaagactcaagcgcttcgggcctgcccactttgaatgcaggctaacaccaatt
ggtgacccaacgatggtggtagaatggcttcatgatggaaagccacttgaagcagccaat
aggcttcgtatgatcaatgaatttgggtattgcagccttgattacggagttgcatataat
agggacagtggtgtcattacttgcagagccactaacaaatatggaacagatcacacatct
gctacccttattgttaaagatgagaaaagtcttgtggaagaatctcaattgcctgagggg
aggaaaggcttacagagaattgaagaattagagaggatggctcatgaaggtgcacttaca
ggtgtaacaacagatcagaaagagaagcaaaagccggatatcgtcttgttcccagagcca
gtgagagtacttgaaggggagaccgctagattccgttgccgagtgacaggttaccctcag
cccaaagtcaactggtacctcaatggacagctcatccgcaaaagcaaaaggttcagagtt
cgctatgatggcattcattatctggacatcgtggactgcaaatcatatgatacaggtgaa
gtcaaggtcactgcagaaaatcctgaaggtgtgatagagcataaagtgaaacttgagatc
caacagagggaagatttcaggtctgtccttaggcgagctcctgaaccaaagcctgagttt
cacgtacatgaacctggaaaacttcagtttgaagtacaaaaagtagatagacctgttgac
accacagaaaccaaggaagttgtgaggttgaaaagggctgaaagaattacccatgaaaaa
gtgtctgaagagtcagaagagctgcgcagtaagttcaagcgcagaacagaggagggatat
tacgaagccattactgctgtagagcttaagtctcgaaagaaggatgaatcctatgaagaa
ctcctgaggaagacaaaagaggaacttctccactggaccaaagagttaaccgaagaggag
aagaaagcccttgccgaggaaggcaaaatcactattccaacttttaaacctgataaaatt
gaactaagtcctagtatggaggctcctaaaatctttgaaagaatccaaagccaaacagtg
gggcaaggatctgatgctcacttccgggtcagagttgtgggaaaaccagatcctgaatgc
gaatggtacaaaaatggtgtcaaaatcgagcgctctgaccgaatctactggtactggcct
gaagacaatgtttgtgaactggtcataagagatgtgactgctgaggactctgccagcatc
atggtcaaagccatcaacatagctggggaaacctcaagccacgcattcttactcgtccaa
gccaagcaattgatcactttcacacaggaattacaagatgttgttgctaaggaaaaagac
accatggcaacctttgaatgtgaaacttcagagccatttgttaaagtgaaatggtataaa
gatggtgtggagattcataagggaaataaatataggatgcactctgacaggaaagttcac
ttcctctctgtgttgacaatcgacccctctgacgctgaagactacagctgtgtacttgtg
gaagatgaaaatgtaaaaacaacggctaaactgattgtcgaaggtgcagttgttgaattt
gtgaaagaacttgaggacatagaagttccagaatccttttcgggagagttagagtgcatt
atatccccagaaaatatagaaggcaaatggtatcacaatggcgtggagcttaaatccaat
ggcaaatacacaattacatctcgccgtggacgtcagaacctcacggtcaaggatgtaacc
aaagaggaccagggagaatacagctttgttgccgatgggaaaaagacaacctgtaaacta
aagatgaaaccccgccccattgctattctacaaggtcttagtgatcaaaaagtctgcgag
ggtgacatcgttcagcttgaagttaaagtctccttagagaatgtagaaggcgtctggatg
aaagatggccaagaagtgcagtccagtgacagggttttcattgtgatagacaaacagtca
cacatgctgctcattgaagacatgaccaaggaggatgctggaaattactccttcaccctt
ccagccctgggactgtcgaccagtgggcgtgtctctgtctatagtgtggatgtgataaca
cctctaaaggatgttaacgtgattgagggcaccaaggctgtgctcgaatgtaaagtttca
gtccctgatgtgacttctgttaaatggtacttaaatgatgaacaaatcaagcctgatgat
cgagtacacgccattgtcaagggcactaagcagcgactagtgattaaccgcacccatgct
tcagatgaagggccttacaagctgatggttggccgagttgaaaccagctgtgatctctct
gtagaaaaaattaaaattatcagaggtcttcgtgaccttacctgtacagaaacccaaaat
gtggtctttgaggttgagctgtcccactcaggaattgatgtcttgtggaattttaagggc
aaggaaatcaaacccaatgctaaatataaaattgaagctcatgggaaaatatataagttg
acggttttaaatatgatgaaagatgatgaaggagaatacacattttacgctggagaaaat
atgacatctggaaaacttaccgtggcagggggtgccatctccaagcctctcacagatcag
acagtagccgagtcccaggaagctgtctttgaatgcgaagttgccaacccagattccgag
ggcgaatggctaagggatggcaaacacctgcctctgagtaaaaacatcagaagtgagtct
gatggccacaaaaggagacttatcatcgctgccagcaaattggatgacattggagaatac
acctacaaggtggccacctccaaaacatctgccaaactcaaagttgaagctgtcaaaatt
aagaagactctgaagaacctcacagtaacggagacgcaggatgctgttttcactgtcacg
cttacacatccaaatgtaaaaggtgtccagtggatcagaaatggggttgtgctggagtcc
aatgacaagtacgatgtctcagtcaaaggaacaacttactctctgagaattaaaaactgt
gctgtttcggatgaatctgtttatggcttcaagcttggaaggctaggagccagtgccaga
ctgcacgttgagactgtcaagatcattaaaaagccaagggatgtgaccgccttggaaaat
gccaccgttgcctttgaagttagtgtttcccatgacacagttccagtaaaatggttccat
aagaatgtggagattaagccgagtgacaaacacagactggtctcggaaaggaaggtccac
aagctgatgctgcagcatatttccccgtcagatgctggggagtatacagctgtggtgggg
caattggaatgcaaagctaagctgtttgtggagacattacatattacaaaaaccatgaaa
aacatcgaggtgcctgagaccaaaactgcctcctttgagtgtgaggtgtcccacttcaac
gtcccttccatgtggctgaagaatggggtggagattgagatgagtgaaaagttcaagata
gtcgtgcagggaaaactccaccagctgctcatcatgaacaccagcacagaggatgcagca
gaatacacgtttgtctgcggcaacgaccaagtcagcgccaccttgaaagtgaccccaatc
atgattacatccatgctgaaggacatcaatgctgaagaaaaagacaccattacctttgag
gtgacagtgaactatgaaggcatttcttacaaatggttaaagaacggtgtggaaatcaaa
tccactgacaggtgccagatgagaaccaaaaagctcacacactcattgaacatcaggaat
gttcactttggagatgctgctgagtacacctttgtggctggaaaagctacgtcgacagcc
acactttatgtggaagctcgtcatatagagtttaggaaacacattaaggacattaaggtt
ctcgagaagaagagagccatgtttgaatgtgaagtctctgaacctgacatcactgtgcag
tggatgaaggacggtcaagaactgcagattgtggacagaataaagatacaaaaggagaaa
tatgtccaccgccttctgatcccatccacccggatgtccgatgctgggcagtacacagtg
gtggcaggaggcaacatgtccaccgctaacctctttgtcgagggcagagatgttcgcatc
cgaagtattaaaaaggaggttcaggttattgagaaacaacgtgctgtcgttgagtttgag
gtcaatgaagatgatgttgatgcccactggtataaagatggaattgaaatcaatttccaa
atccaagaaagacatcaatatgtggtggagagaagaatccaccgaatgttcatctctgag
accaggcacagtgatgccggtgaatacacctttgtggcaggaaggaacaggagttctgtt
actctttatgtcaatgctccggaaccaccccaaattctgcaggagctccagcctgttact
gtgcaatctggcaagcctgcccgcttctgtgctgtgatatccggcagaccgcagcccaaa
atttcttggtacaaggaagagcagctgctttccactggcttcaagtgcaaatttcttcac
gatgggcaagagtacacgcttttgctaatcgaagccttcccagaggacgcggctgtctac
acctgtgaagccaagaatgactatggagttgcgacgacctcagcttcactctcagtggaa
gttccagaagttgtgtctcctgatcaggaaatgccagtttatcctcctgccatcatcacc
ccgcttcaggacactgtcacttctgagggacagccagcccgttttcaatgcagcgtttct
ggaacagatctcaaagtgtcttggtacagcaaagacaagaaaatcaagccatctcggttc
tttagaatgactcagtttgaagacacttaccagttggagattgctgaagcttatccagaa
gatgaagggacttacacttttgctgctagtaatgccatgggtcaagtatcgagcacagcc
aacttgagactggaagcccatgaatcgcttttacatgagaggattgaagaacagattgag
gtggagatgaaagctgctccagtgctcaggaggagaatcgagccccttgaagtggctctg
ggccatctagccaagttcacctgtgagatccagagtgcccccaatgtgcggttccagtgg
tttaaggctggccgacaaatttacgacagtgacaagtattctatccgatcttcaaagtat
gtctccagcctggaaatcctgagatcccaggttgttgactgtggcgagtacacctgcaaa
gcttccaatgagtatggcagtgtcagctgtacagccacactgaccgtgacagaggcatat
ccaccaaccttttactccagacctaaatccgttacaacttttgtgggtaaggcagccaag
ttcctctgcacagtgctaggaactcccgtgattgaaaccgtttggcagaaagatggcgcc
gcgctatcgccttctcctaactgcaagatttcagatgcagaaaacaaacacattttagaa
ctctcaaatcttacaatacaagaccaaggagtttactcttgcaaggcttccaacaagttt
ggagccgacatctgccaagctgagttgatcataatcgacaaaccgcatttcattaaagaa
ttagagcctgtgcaatcggctatcaataagaagatccaccttgagtgccaagtagatgaa
gacagaaaagtcacagttacatggaagaaggatggtcaaaaactgccccccgggaaagat
tttaagatctattttgaagataaaatagcatcacttgagatccctctggccaaagtaaaa
gattcaggaacctatgtttgcacagcttccaatgaggcaggcagcagctcctcttcagca
acggtaaccatcagagagccaccatcctttgtgaagaaggtagagccctcttatttaatg
ctccctggtgaatcagcccgcctccattgcaagctgaaaggctcgcctgtgatccaggtt
acttggtttaaaaataacaaagaacttaatgagagtaacacaatccgaatgtcttttgtc
aattctgaggctgtacttgatattacggatgtgaaagttgaagacagcgggagttactcc
tgtgaagccgtgaatgacgtgggcagtgacagctgcagtgctgaaatagttgtcaaagaa
cctccttctttcatcaaaactctcgagcctgcagatatagtgagaggatcaaatgccctc
cttcagtgtgaagtcgcaggcactggaccatttgaaattagctggttcaaagataagaag
caaattcgaagtagtaaaaagtacaggttgttttctcagaagtctcttgtgtctctggag
atctttgcttttaacagtgccgatgttggtgaatatgaatgtgtcgttgctaatgaagtt
gggaagtgtggctgccttgcaacacacttattaaaagaaccaccaacctttgtaaagaag
gtagatgattttaccgcactagcaggacagactgttaccttacaagctgctgtgagaggg
tcagaacccatttctgtcacatggatgaaaggacaagagatcattaaagaagatggaaaa
atcaaaatgagcttttccaatggtgttgccgtcttgataatccccgatgttcagattagt
tttggtgacagatacacatgcctggctgaaaacgaagccggaagccaaacgtctgtaggg
gaattaacagttaaagaacctgccaaaatcattgagagagcagagctgatccaggtgaca
gcgggggacccagccacactggagtatacagtcacaggcaccccagaactcaagcccaaa
tggtacaaagatgggagacctttgattgctagtaaaaagtatcgaataagttttaaaaac
aatgttgcccaactcaaattttattcggctgaactgcatgatagtggccaatacacattt
gagatttccaatgaagtgggcagcagctcctgcgagacaactttcactgtattagatcga
gacattgctccgttttttaccaaacccctacgcaacgtggatagcattgttagtggtacc
tgcaggctggactgcaaaatcgctggctccctccccatgagggtatcttggtttaaggat
ggcaaagaaatagcttcttctgacagatacagaatagcatttgtggaaggcacggcctct
ttggagataagcagagtagacatgaatgacgcggggaatttcacttgtcgagccacaaat
tctgtgggaagcaaagacagcagcggagccctgattgtgcaagaaccacccagttttgta
accaaacccgcatcaaaggatgttctgcccaactctgcagtctgcctgaagagcaccttc
caggggtctactcctttcacagtcagatggtttaagggtgacaaagagctggtttctggt
ggaagctgctatattaccaaagaagctttagaaagttccctggaactctatgcagtaaaa
acctctgattcaggcacatacacctgtaaaatcagcaatgtcgctggaagcgtggagtgc
agtgcaaacttatttgtaaaagaacctgccacctttgttgagaagttagagctatcacag
ctattaaagaaaggagacactgccgagctagcctgcaaagtaactggtacccctccaatt
aaaataacatggtttgtgaatgatagagaaattaaggaaagcagcaagcacagaatgtct
tttgtggaatccagtgcggtcctaagactcacagatgttgccactgaagacagtggcgaa
tacatgtgtgaggctcaaaatgaggctggcagtgaccactgcacaggcgttttaatagtc
aaagaggcaccttactttaccaaggaatttaagccaatcgaagtgttgaaggagtacgat
gtcatgttgctggccgaggtggcaggcactcctccctttgagatcacttggttcaaagac
aacacaacgctgcgaagtggtagaaagtataaaaccttgattcaggatcagctggttagc
ctgcagatcctcaagtttgtagccgcagatgctggcgaataccagtgtcgggtgaccaac
gaggtgggcagcagcacctgcagtgccagggtgactttaagagaacccccaacctttgta
aagaggattgagagcaccagctctcttcgaggaggcacagctgccttccaggcaactctg
aagggctccttgccaatcacggtgacttggttaaaagacaatgatgaaatcactgaagat
gaaaatataagaatgacctttgagaacaatgtggccagtctgtacctcagtggcattgaa
gtcaagcatgatggcaaatatgtctgtcaggccaaaaatgatgcaggaatacaaagatgt
tctgcattactctcagtaaaagaacctgcaacaatcaccgaggaggctgtgtctatagat
gtcacccaaggagacccagccaccttgcaggttaaattttcagggactaaggagattaca
gccaaatggtttaaaggtggccaagaactgaccctgggccaaaaatataaaatcagtgtc
actgacacagtctctatactgaagattatttctactgaaaagaaagatagtggagaatac
acttttgaggtccaaaatgacgttgggagaagcagctgcagggctagcattaatgtatta
gatcttattatacctccctcattcaccaaaaagctgaagaaaatggacagcattaaaggg
tcttctattgatttagaatgtatagttgctgggtcacatcccataagcatccaatggttc
aaagatgaccaagaaatatcagctagtgaaaaatacaaatactcttttcatgacaatact
gccttcttggagatcagtcacctggaaggtacagacagtgggacatacacttgttctgcc
actaataaggcaggacacaaccagtgcagcggccatctgacagtcaaagaacccccttac
ttcgtagaaaagcctcagtcacaagatgtcaatcccaacacaagggttcagttaaaggct
cttgtgggtggcactgcgcccatgacaataaagtggtttaaagacaacaaagagttgcac
tcaggagcagctcgctcagtttggaaggatgacacctccaccattctcgagctcttttca
gccaaagctgccgactctgggacctacatttgccaactaagcaatgatgttggcacagtg
accagtaaagtcactctctttgtgaaagaacctcctcaattcattaagaagcccagccca
gtcttggtgctgaggaatggacaatctacaacattcgaatgccaaataacaggcactcct
gaaatcagagtttcttggtatctggacgggaatgaaataacagccattcggaaacatggc
atttccttcgttgatggtttagccactttccaaatttctggtgccagggtagaaaatagt
gggacttacgtctgtgaagctcgtaatgacgcaggcacagcaagctgcagcattcaatta
aaagtgaaagaacctcccgcctttatcagggagctgcagccagtggaagtagtgaaagac
agtgacgtggagctggagtgtgaagtgatgggaacatctccatttgaagtcacttggctg
aagaataatagggaaattcgaagcagcaaaaaatataccctgagtgacagagtctcagtg
ttttacctccatataaccaagtgtgacccttcagacactggtgaataccagtgcatcata
tccaatgaaggtggcagctgctcatgcagtgctagagtctccttgaaagagccaccatca
ttcattaagaagatagaaaatgtcactactgttttgaaaagttctgccacatttcagagc
accgtggcaggctctcctcccatttctgtaacctggctgaaagatgatcagattcttgat
gaagatgataatgttcatatttcatttgtgaacaatgtggccacacttcagatcagaact
gtggataatggacacagcgggagatacacgtgtcaagccaagaacgagtcaggagttgag
aggtgttatgctttccttttagtacaagaacctgctcagatcatagagaaagctaaatct
gttgatgtcaccgagaaagacccagtgaccttggagtgtgttgtggcgggaacaccagaa
ctcaaagtgaaatggcttaaagatgggaaacaaattgtgcccagtagatacttttcgatg
agttttgaaaataacgtggccagcttcaggattcagtcagtaatgatgcaagacagtggt
cagtatactttcaaggtggaaaatgactttggaagcagtagctgtgatgcctacctgcga
gtgctagatcaaaatattcctccatcattcaccaaaaaattaaccaaaatggataaagtt
ctgggctcttctgttcatatggagtgcaaggtttctggctcacttcctattagtgctcag
tggtttaaggatggaaaagaaatatctacaagtgcaaaatacagacttgtctgtcacgag
aacactgtgtcactggaagttaataatctggaattagaagataccgcgaattacacatgc
aaggtctcaaatgtagcaggggatgacgcatgcagcggcatcttaactgtgaaagaaccg
ccaagcttcctggtgaaacctgagcgacaacaagccatacctgattctacagtggaattc
aaagcagtactgaaaggaacaccaccatttaaaatcaagtggtttaaggatgatgtggaa
cttgtctctggacctaaatgtttcattggcttggaagggtcaactagcttcttaaatctc
tattcagtggatgcttccaagactggacaatatacttgccaagttaccaatgatgttggt
agcgactcttgtactacacttttgttcgtgacagaaccaccaaagtttgtaaagaaatta
gaagcatccaaaatagtgaaagcaggtgactcagcacgacttgaatgcaagataactgga
tccccagaaataagagttgtgtggtacagaaatgaacatgaactcccagccagtgataaa
tacagaatgactttcattgactcagttgccgtcattcagatgaacaatctcgggactgaa
gacagtggggatttcatttgcgaggctcagaatcctgctggcagcacaagctgcagtacc
aaggttatagtaaaagaaccacctgtttttagcagcttccctcctgtagtagaaaccctt
aaaaatactgaagttagtcttgaatgtgaactttcgggaacaccaccatttgaggtggta
tggtacaaagacaagcggcaactcagaagtagcaagaaatacaagattgtgtccaaaaac
ttccatgcaagtatccacattctcaatgtggaaacttcagacatcggtgaatatcactgc
aaggcacagaatgaagtgggaagtgatacttgcatttgtactgtacaactgaaagaacca
ccaagatttgtgtccaaactgaacagcctcaccgttgtagctggtgagcccgccgagttg
caagcgtccatagaaggcacccagcctatttatgtccagtggcttaaagagaaggaagaa
gtgattagagaaagtgaaaacatcagaattacacttgtggaaaatattgcaactctgcag
attgcaagagcagaaccagctaatgctgggaagtatatctgccaaatcaagaatgatggc
ggaacgagggagaacatggccacattgactgttctagagcccgcagtcattgtcgagaaa
gcaggatcaatgacagtgactgtaggagaaacgtgcactctggagtgtaaggtggctggc
actcccgaactctcagttgaatggtacaaggatggaaagctgttgacaagcagccaaaaa
cacaaatttagcttctacaacaaaatctcttccttaaagattctctctgttgaaaagcaa
gatgcaggcacatacactttccaggttcaaaataatgttggaaaaagcagctgcacagct
gtggtggatgtctcagaccgaacggttcctccttctttcacacgaagactgaaagatact
ggtggggttctgggtgcttcttgcatcttggagtgtaaagtagctggatcatcacctatc
tctgttgcctggtttcatgagaaaactaagattgtcagtggagcaaagtaccaaaccacg
ttttcagataatgtctgcacgttgcagctgaattccctggactcatcagatatgggcaat
tacacatgcgtggctgctaacgtagctgggtctgatgaatgtcgtgcagtgttggctgta
caagaaccaccctcttttgtgaaggaacctgaacctttggaagtactaccaggcaagaat
gtcaccttcacaagtgttattagaggaacctctcccttcaaggttggctggttcagaggt
gccagagaactggtgaaaggagacaggtgcaacatctattttgaagacactgtggcagag
ctggaattatttaatgtcgacatatctcagagtggggaatatacctgtgtggtttctaac
aatgctggccaaacattctgcactactcgtctctatgtaaaagaaccagctgcatttgtg
aagaagttaagcgatcattcggtagaaccggggaagtcgataattctggagagtacctac
actggaacacttccaatttcagttacctggaaaaaggatggttttaacataactccatct
gaaaaatgcaacatagtcacaacagagaaaacttgcctcctggaaattctgaatagcaca
aaaagagatgcaggacagtattcctgcgagattgaaaatgaggcaggaaaggatgtgtgc
gaagctctggtatctaccttagaaccaccttatttcgttacggaactggaacctctggag
gcctcggtgggagattcagtttctttacaatgccaagttgctgggacaccagaaattaca
gtgtcttggtacaaaggagacaccaagttacggccaactcctgaatacaggacctatttt
acaaacaatgtggccacacttgtttttaataaagtaaatatccatgacagtggagaatac
acatgtaaagcagaaaatagtataggaactgcttcttctaagactatcttcagaattcaa
gagcgccaactcccaccttcctttgcaagacaattaaaggacatcgaacaaactgttggg
ttaccggttacactcacttgtcgattaaatggctctgcacccatccaagtgagctggtac
agggatggggtactcttaagagatgatgaaaatctacagacatcatttgtagataacgta
gcgactttaaaaattttgcaaacggacttgagtcactctggccagtactcttgctcagct
tctaatccacttggaacagcatcttcaactgctagactgacagcaagagaacctaagaaa
tctcccttctttgacatcaagcctgtatctatagatgttatagctggggaaagtgctgac
tttgagtgtcatgttactggtgctcaaccaatgcgaatcacttggtcaaaagataacaag
gagatccgtcctggaggaaactatacaatcacatgtgtgggaaacactccccatttgaga
attcttaaagtaggcaaaggagactctggtcaatatacttgtcaagcaaccaacgatgtc
ggcaaagacatgtgctcagctcaactcagtgtaaaagaacctccaaagtttgttaagaaa
ttagaagcttcaaaagttgcaaagcagggagaatccacccaactggagtgcaaaataagt
ggttccccagaaatcaaagtgttgtggttccgaaatgacagtgaacttcatgaaagttgg
aagtacaacatgtcattcgttaattctgtggcattgcttaccatcaatgaagccagcact
gaggacagtggggactatatctgtgaagctcacaatggtgttggcgacgccagctgtagc
acagcgctgactgttaaagcacctcctgttttcacccagaagccttctccagtaggagcc
cttaaaggttctgatgttgtcttccaatgtgaaattgcgggaacacccccatttgaagtg
gtgtgggttaaagatcgaaagcaagttcgaagcagcaagaaatttaaaatcacttcgaaa
aattttgatacaagtcttcatatccttaatcttgaagcctccgatgtaggagaatatcac
tgcaaagctagtaacgaggtgggaagtgacacgtgtgtttgcactgtcaagttccaagaa
cctccacgatttgtgaaaaagctaagtgacacctcaacccttgttggggatgctgttgag
ttacgggctgtagtggaaggcttccagccaatttctgttgtctggctgaaagataaaggg
gaagtcatcagagagagtgaaaacactaggatttcattcattgacaacgttgcaactctc
caacttgggagcccagaagcatctaattctggaaaatatgtgtgccaaatcaaaaatgat
gccggaatgagagaatgttctgcagtcttgactgtactagaaccagccagaatcatagag
aagccagaacccatgacggtcactaccggaaatccttttgcattagagtgtgtagtgact
ggaacaccagaactttcaaccaagtggttcaaagatggaagagaattatctggagacagc
aaacatcacattacatttgtcaacaaagtggcttcccttaaaatcccctgtgcagaaatg
agtgacaagggattatatagctttgaggtgaaaaacagtgttggtaaaagtaactgcact
gtatctgtccacgtttcggatcgagtcatccctccttccttcatccgcaagctgaaagac
ctgaacgccatcctggggtcctcagcggttttggagtgccgagtcgctggctcggccccg
atttccgttggctggtttcaggatggaaatgagatcattagtgggcctaaatgccagtcc
agcttttcggaaaatgtctgtactttgaatctgagctcactggagccctctgacacaggc
gtctacacatgtgtggctgccaacgtggctggttctgacgaatgctcagcagtcctgact
gtgcaagaaccaccatcttttgaacaaacccctgattctgtggaagttttacctggagtg
agcctcacattcaccagcatctttagaggcacccctcctttcaaggtcaaatggtttaag
ggcagcagggaactggtgtcaggtgactcatgcaccatctctctggaagattatgtctcg
gaactggagttgtttgaggtggagccactgcagagtggagactattcttgcctcgttact
aatgatgctggcagtgcttcctgtaccacacatctgtttgtgaaagaaccagccaccttt
gtgaaaagattggctgatttcagtgtggagacaggaagccccatagttcttgaggccaca
tttactggcactccgcccatctcagtgagctggatgaagaatgaattccctctctcacag
tctcagaattgcagtattaccatgacagaaaaatctacgatactggaaattcttgacagc
acgatagaagattatgcacagtacagttgcctgatagaaaatgaggctggtcaagatatt
tgtgatgctctggtgtctgtcttagaaccaccttatttcattgaacctctggaacatgtg
gaagcaaccattggagaacctacaactttacagtgtaaagtggatggaactccagaaatt
agaatttcttggtataaagaacacacaaagctacgatcagctcctgcatataagatgcaa
ttcaaaaataatgttgcctccttagtaattaacaaagtggatcacagtgacgtgggagag
tattcatgcaaggcagaaaacagtgtgggggcagttgcttcttcagctgtgcttgtcatc
aaagagcgcaaacttccaccttcctttgcgagaaaactaaaggatgttcatgagactctt
ggcttcccagttgcatttgagtgtcgcatcaatggctcagaacctcttcaagtgtcttgg
tacaaggatggggtacttttgaaagatgattctaatttgcaaacatcttttgttcataat
gtcgcaactcttcagattttgcaaaccaaccagagccacgttggtcagtacaattgctca
gcttctaatcctcttgggactgcttcatccagtgccaagctcattctctcagagcatgaa
gttcctcctttctttgatctaaagcctgtctcagtagatctggctcttggagaaagtggt
tcttttaaatgtcatgtaactggaactgcaccaatcaaaatcacttgggccaaggataac
cgagagattcgccctggtggcaactacaagatgactttggttgaaaatactgccactctg
acagttctcaaagtaggcaaaggtgacgctgggcagtacacctgctatgcaagcaacgtt
gctggaaaagattcttgttctgctcatctgggtgtacaagaaccacccagattcattaag
aagcttgaaccttcaagaattgtgaaacaggatgaatacacaagatatgaatgtaaaata
ggagggtctccagaaatcaaagttttatggtacaaagatgagactgaaattcaagagagc
agtaaattcagaatgtcattccttgactcggtggcggtgttggaaatgcacagtctcagt
gttgaagacagcggagactacacatgtgaggcccgcaatgcagcaggcagcgccagcagc
agcacttccttaaaagttaaagaaccacccattttccacaaaaagcctcatcctgttgag
acactgaaaggagctgatgttcaccttgaatgtgagcttcagggtactcctccgtttcaa
gtttcttggtataaagacaagagagaactcaggagtggcaagaagtacaagataatgtct
gagaacttccttacgagtattcacatcctgaatgtcgatgctgcagacattggggaatat
cagtgcaaagccacaaatgatgtggggagtgacacctgtgctggttccatcactctgaaa
gcaccaccaagatttgtgaagacgctcagtgacatttctaccatcgttggtgaagaagtt
cagctgcagactgctattgaaggcgctgagccaatttcagtggtgtggttcaaagataag
ggagaagttgttagagaaagtgacaacatatggatttcttattcagaaaacattgcaacc
ctacagttttcacgagcagaaccagccaatgctgggaaatacacctgtcaggtcaaaaac
gatgctggaatgcaagagtgcttcgccacactatctgttcttgaacctgcagcaattgtg
gaaaagccagaatccatacaagttaccacgggagatacctgtaccttggagtgcacggtc
actggcacacctgaactcagtaccaagtggtttaaggatggaaaagaactgacaagtgac
agcaaatacaaaataagcttcttcaacaaagtatctggccttaagattatcaacgtggca
cccggtgacagtggagtatatagttttgaggtgcaaaatcctgttggcaaagacagctgc
acagcctcagttcgagtctcagaccgaattgttgctccttcattcacaagaaaattgaaa
gagacaaatggtctgtctggttcctcggttgtaatggagtgcaaagtctatggatcacct
ccaatctctgtctcctggttccatgaaggaaatgagatcagcagtggaaggaagtaccag
accaccctgacagataacacttgtgctttaactgtgaacttgctggaagaatcagatgct
ggcgactacacatgtgtagctactaacatggctggttctgatgaatgcagtgctcctttg
actgtgagagaaccgccatcttttgttcagaaacctgatgccatggatgttttaactgga
accaatgtaactttcacgagcatcataaaaggaacacctcccttcatggtcagctggttc
aagggtagcagtgaacttgtaccaggggacagatgtaatgtgtctttggaggattcagtt
gctgaactggagttgtttgatgtagatacaatgcaaagcggagaatacacatgcatagtc
agtaacgaagctggcaaggcttcttgtacaacacatctccatgtaaaagccccagccaaa
tttgtgaagaggctcaatgattacagcatagagaaaggaaaacacctgatcctagagggc
acctacactggaactcctcccatttcagttacatggaagaaaaatggcataaatatcgct
ccttctcagaggtgccatataaccacaactgaaaaatctgcaatcctggaaattccaagc
agcacagtagaggacgcaggacaatacaactgctacatcgaaaatgcttccggaaaagat
tcctgttcagcacaaatcctgatactagaaccaccatattttgtcaagcagttggagcct
gttaaggtgaccgttggagattctgcctctttacaatgccaacttgctgggacccctgaa
attggggtatcctggtataaaggagatacaaaattgagacccactgccacctacaaaatg
cattttaagaacaatgttgctaccctggttttcaaccaggttgatgttaatgacagtgga
gaatatatctgcagagctgaaaacagtgtgggagaagtgtcgtcatccactttcctgact
gttcaagagcaaaaacttccaccatcattttctcgacaattgagagatgttcaagaaact
gttggactgccagttgtttttgaatgtgccataaatggatcagaacctatctcagtgtct
tggtataaagacggcaaaccgttgaaagacggcccaaacgtacaaacatcgtttttagat
aatgtagccactctcaatatttttaaaacagatcggagccttgcaggccagtattcttgc
acagccacaaatccaatagggtctgcttcttctagtgccagactcattctcacagagggg
aagaacccgcccttctttgacatccccgttgcccctgtggatgctgtggtgggagaaagt
gcagactttgagtgccacgttactgggacacaaccaataaaggtcggctgggccaaagac
aacagagagatacgaagtggtggaaactaccagattagttttctggaaaacagcgcccat
ctgacaatcctgaaagtagacaagggagactctggacaatatacctgctacgctgtgaac
gaagtgggaaaggactcctgcacagctcaactcaacataaaagagcggctcatcccacca
agtttcactaaaaaactctcagagacagtggaagaaacagaagggaattctttcagactt
gagggccgcgttgcgggttcccagcctataactgttgcttggtacaagaataatgtagag
atacatccaacttctaactgtgaaatcacattcaagaacaacacactcctgctgcaagtc
aagagggcgggcatgggcgatgctggtttgtacacgtgcaaagtgtggaatgatgcaggc
tctgctctgtgtacatcttcaattgttatcaaagaacctcagaagccacctgtgtttgat
cagcaccttactccagtaacagtgagcgaaggtgaattcgtgcagctcagctgccacgtc
cggggttcagagccgatcaggatccagtggttgaaggctggcagggaaataaaaccctca
gacagatgcagcttcagctttgctagtggaaccgctgtgctggaactcaaggacgtgact
aaagcagattcgggagattatgtgtgcaaagcttcaaatgtggctggaagtgacacttcc
aaatcaaaagtgaccgttaaagacaaaccagctgcagtcccagccgctaagaaagcagca
gtggacgggaaactcttcttcgtatcagaacctcagagtatcagagtcgtagaaaaaacc
actgcaacattcattgccaaagttggaggtgatccaatcccaaatgttaaatggacaaaa
gggaaatggagacaactgaaccaaggaggtcgcatttttatccaccagaaaggcgatgaa
gcaaagctggagattagagacaccacgaaaaccgactctggactataccgatgcgtcgca
tttaataaacatggtgaaattgaaagtaatgttaacctacaggtggatgaaaggaagaaa
caagagaaaattgaaggagatcttagggcaatgctgaaaaagactccagtcttaaagaaa
ggagctggagaagaagaggaaattgatatcatggaacttctcaaaaatgttgatcctaaa
gaatatgaaaaatatgcccgtatgtatggaatcactgacttccggggtcttcttcaagca
tttgaactgctaaagcaaagtcaacaagaagagacacatagattggaaattgaggaaata
gagaagtcagagaaggaagaaaaggaatttgaagaacttgtatcatttattcagcaaagg
ctgtcacagacagagcctgtcactctgatcaaggatattgaaaatcagacagttttgaaa
gataatgatgctgtgtttgaaattgatattaagattaattatccagaaatcaaactctca
tggtacaaagggactgaaaaactggaacccagtgataaatttgaaataagcatcgatggt
gatcgacatacactcagagtcagaaactgtcagcttaaagatcagggcaattatagattg
gtgtgtggtccacacatcgctagtgctaaactcactgtaattgagcctgcttgggaacgg
catcttcaagatgttactttgaaagaaggccagacttgcaccatgacatgccaattttct
gtgccaaatgtaaaatctgaatggttcagaaatggcagaatccttaaaccccaaggtaga
tacaaaacagaagtggaacacaaagtccataagctgaccattgcagatgttcgagcagaa
gaccagggacagtacacctgcaaatacgaagaccttgaaacatcagcagagctcagcatt
gaagctgaaccaattcagtttacgaaacgcatacagaacattgtggtgagtgagcatcaa
tctgccacctttgagtgtgaagtgtccttcgacgacgccattgtaacatggtacaaagga
ccaacagaactgaccgagagccagaaatacaactttagaaatgatggtcgctgccattat
atgaccatccacaatgtgaccccagatgatgaaggtgtctattcagtaattgctcgcctg
gagccaagaggtgaagcgagaagcacggcagagctgtacttaacaaccaaagaaatcaaa
cttgagatgaagcctcctgatattcctgactccagagttccaatcccaaccatgcctatc
agagcagtgccaccagatgaaatccctcctacggctattcctcctatccctctgttacta
ccagcacctgaagaaaagaaaccaccagcaaaacgtgttgaagtgaccaaaaaagccaag
aaagtcgcaaagcccaaagaagaggcaccgccgcctaaagtcccagaggttgccaagaag
cccccacctcccactgctttaattccagccaaagctcctgaaattattgacgtatcctcc
aaggctgaagaagtaaaaataatgaccataaccagacagaaagaggttcagaaagaaaaa
gaagctgtgtatgagaaaaagcgagcagtctatgaggagaaaaaacttttcatcgaatct
ttggaagaaccatatgacgaactggaagtggaaccatacacggagccatatgaagaacct
tactacgaagaaccagatgaagactatgaagagaccaaggtagaaaccagaaaggaagtt
catgaggaatgggaagaagattttgaagcagggcaagaatactatgaaagggaagaaggt
tatgacgaaggggaggaagagtgggaggagacttaccaagaaagagaagcagttcaagtt
caaaaggaggtttatgaagaaccacatgagagaaaaattccagcaaaagtgcctgaaaag
aaagaagcaccacctcctaaagttgtaaagaagccagtagttgaaaaaattgaaaagact
tctcgaagagtggaggaagcaaaagttcaagtcaccaaagtacccgaagtttcaaagaag
attgttccacaaaaaccttcccggactccagtgcaggaagaagttattgaagtgaaagta
ccagctgtgcatacagagaagatggttatttcagaagaaaagttctttgcttctcacaca
gaggaagaggtgtcagtcacagtccccaaggtacaaaagaaaactgttaccgaagagaaa
attcaagttgctgtttccaaaaagattgagcctccacctaaagtccctgagccacctcgg
aaaccagccccagaagaagtgctccctgttcccattcctaaaaaggtggaacccccacca
gccaaagttcctgaagttcccaagaaacctgtgccagaagagaaaaagcctgttcctgta
cccaagaaggaacctgctgctcccccaaaagtcccagaggtgccaaagaaacctgtccct
gaagagaaggttcctgttcctgttgcaaagaaaaaggaagctccaccagctaaagttgct
gaagtgcagaagagggttgtcacagaagaaaaagtaaccattgttactcaaagagaggaa
tctccaccaccagcagtgccagaaataccaaagaagaaagttcctgaagaaaaaagacct
gttcctcggaaagaggaagaagctccaccaccaaaagtgccagctccgcctaagaaaccc
gtcccagaggagaaagttcctgtaccagttcctgtccctaagaaagctcctcctccccga
gccgaagtgtctaagaaagctgtcgtagaagaaaaaagatattttgccgaagaaaaacta
tccgttgcagttcctcaaagaacggaagtcatgcggcatgaagaggaagaatggagttat
tcagaagaacaggaaagagtgtccatttcagtttatagagaagaagaaagagaggaggag
gaagcggaggttacagaatatgaagtgatggaagagcctgaggaatacgttgtggaggaa
gagctgcacgttattgctgagagagtggaagctgagccagcagaagtgcctgagaagaaa
attgtaccaaaaccgaaaattcctgctaaaatagaggagccttccccagctaaagttcct
gaaccacctaagaaaatcgtgccagaaaagaagcttcctgctgctgttcctaagaaggaa
aaggtgccaccagctaaagtgccagaagagccaaagaaaccagttccagaaaaaagggct
cctccaaaagtggctaagatagaagagcctgtccccaccaaagtgactgagaggcacatg
caaattacccaggaagaaaaagttcttgttgctgtaactaaaaaagaggagcctccaaga
gcaagagtgccagaagaacccaagagagctattccagaagagaaagttccaaaactcaaa
cctaaaaaagaggaggagccaccaacaaaagtggctgaaatcaggaaaagagctgttaaa
gaagaaaaggtatccattgaagttccaaaaagagaacctcaattcgctaaagaagtagct
gtagcagaagagaaagaatggtcttatacccgagaagaagaggttgtctcagtacaacgg
gaagaggaatatgaagaatatgaagaagaatatgattacaaagaatttgaggagtatgaa
ccaacagaagagtatgagcaatatgatgaatatgaggaacgtgaatttgaacattatgaa
gagtataaagaacgtgaagaatatgtcacagagcctgagaagcctgtcccagttaagcct
gtccaagaagaaccagttcccacaaagccaaaggccccaccagtgaaagtgccgaagaaa
gctgtccctgaagaaaaagtaccagtgcccattcctaagaaactcaaacctgtgccaccc
aaagtgactgaagaagcaaagaaagttgttgaggaaaaaatacacatttcaattaccaaa
cgtgaaaaagagcaggtgaccgaaccaactgctaaagtgcccctgaagctcaaaagggtt
gtcactgaagaaaaagtaccagttcctaaaaaggaagtagccgcacctgttagagtgcca
gaagtacctaaaagacgagaaccagaagagatagcctttgaagaggaagttgtaacccaa
gtagaggaatatcatgaagaagaagaagagtacatttacgaagaagaggaactcgtaact
gaagaagaagtggtaccagtgataccagtcaaagtgcctgaggtacccaagaaacctgtt
ccagaagagaagaaacctgttcctgttcccaaaaagaaggaagccccaccagcaaaagtg
cctgagattcctaagaagccagaggaaaaagttcctgtgcccattcctaaaaaagagaag
gctccaccagctaaagttcctgaggtacccaagaaacctgtaccagaggagaaagtgcca
gtaccagttcctaaaaaggtggaagctccacctgccaaagtgccagaagtgcccaagaaa
cctgtgcctgagaagaaggtgccagttcctgttcctaagaaagtagaagctccacctgca
aaagtgccagaggtgcctaagaagatcatcccagaagaaaagaaaccaacacctgttccg
aaaaaagtggaagctccaccacccaaagttcctgaggtacctaagaaagtggaagaaaga
ccaatcgttgtccctgaagaagaggaagttccaccagttgaagtgtttgaggagcctgaa
gagcctattccagaagaagagatcccagaagaaccacctaccatagaggaggaggttgaa
gaagtcgcgccacctagagtgcctgaagtggtcaagaaagcagtacctgaagcacctact
cctgttcctaaaaaagtagaggcaccaccagctaaagttccaaagaaggttcctgaggaa
aaagtacctgttcctgttcagaaaaaagaggcacctccagccaaagtgcccgaagtacaa
aagaaagtcccagaaaagaaagtcccagaaaagaaaataccagaaaagaaagtcccagaa
aagaaagtccttgtgcctaaaaaagaagctgttcccccagctaaagatgctctttcaggg
aggactgtcgaagaaaaaatatcagttgccttccacaaagaggaagtagttagagaaaga
acagaatttgaaatagtagaagcggaagcggttcttgaggaagaagagttccatgaagtt
gaagaatattttgaagaagaagagttccacgaagtagaagaattcaccaaagtggaagag
cacagatttgaagaagtccacgaggttgaagaggtccatagggtaatagaagttttagag
gctgaagaagtggaagtttacgaagaacccaaagctccacctaaagggcctgagatatct
gagaaagtcgtccctccaaaaaaaccacccactaaagttgttcctcgaaaagaaccacca
gctaaagtgcctgaggctcccaaggaagttgttcctgaaaagaaagtgcctgcgccacct
cctaaaaagccggaagtcccacctgttaaagtgcccgaggctcccaaggaagttgttcct
gaaaagaaagtgcctgcggcacctcctaaaaagccggaagtcccaccagccaaagtgcct
gaggtgccaaaggcagctgtcccagaaaagaaagtgcctgaagctattcctcccaaaccg
gaaagtcctccccctgaagtgcccgaggtgccgccaaaggaagtcatccctgaaaagaaa
gtgcctgtggctcctcctaagaagccagaacctccacctgctaaagtgcctgaagctccc
aaagaagttgttcctgaaaagaaagtacctgtgccacgtcctaaaaagccagaagttcca
cctgtcacagtgcccgaagctcccaaggaagttgttcctgaaaagaaagtgtctgtggca
cctcctaaaaagccagaagtcccacctgttacagtgcctgaagctcccaaagaagttgtc
cctgaaaagaaagtgcctgtgccacctcctaaagagccagaagtcccacctgttaaagtg
cccgagcctcccaagaaagttgttcctgaaaagaaagtacctgtggcacctcctaaagag
ccagaagtcccacctgttacagtgcctgaagctcccaaagaagaaatcatccctgaaaag
aaagtgcctgtgccacctcctaaaaagccagaagtcccacctgtgaaagtgcccgaggct
cccaaggaagttgtccctgaaaagaaagtgcatgtgccacctcctaaaaagccggaagtc
ccacctgttaaagtgcctgaggctcccaaggaagttgttcctgaaaagaaagtgcctgcg
ccacctcctaaaaagccggaagtcccacctgttaaagtgcccgaggctcccaaggaagtt
gttcctgaaaagaaagtacctgcggcgcctcctaaaaagccggaagtcccaccagctaaa
gtgcctgaggtgccaaaggcagctgtcccagaaaagaaagtgcctgaagctattcctccc
aaacccgaaagtcctccccctgaagtgtatgaggagcctgaggaagttgttccggaagag
cctccagctgaagtggtggaagagccagagcctgcccctccccgcaaagtgactgtgcca
cctaagaaacctgtcccagagaagaaaccacctgctgtcattgccaaaaagcctgaacca
ccaccagtgaaagtgcccgaggtgcccaaggaagttgttcctgaaaagaaagtgcctcca
gtggttctcaaacagccagaagtcccgcctgctaaagtgcctgaagttccaaaagaagtt
gttccagaaaagaaagtagctgttcccaaaaagccggaagtcccaccacccaaagtgcca
gaggtgccaaaggaacctgtcgtggaagagaaaccagctgttcctattcccgaagaagtg
gagccgcctcctccagaagtatatgaagaacccgaggaaattgctcctgaagaggaagag
ccagttcctgttgcagaggaggaaccagaggcgcccccaccagcagtgcctgaagagccc
aagaagattgttccagagaagaaagtgcctgtcatcaaaaaaccagaagctcctcctcct
aaagaacctgaacctgaaaagaaggttgttgagaaaccaaaactcaaaccaaggccccca
gctcctgctcctgctccacctaaggaagacgtgaaggagaaaatagcccaacttaaagct
gtttcaaagaagaaagttcctgaaaaacctgaggttccagaaaaagtggagcttaaacct
ctgaaagtgcttggaggggaaaagaaagttcgcaaattacttcctgaacctaaaccacaa
ccaaaggaagaagttgttctcaaaagcgttctaagaaagaaacctgaagaagaagaacct
aaagtagaacctaaaaaagtagaaaaagttaaaaaacctgcagtaccagaaccacctcca
aagcctgttgaagaggttgaagcacctccagctgctgttacaaaaagggaaaagaaagtt
cccgaaccaacaaaagtgcccgaaattaagccaccaatacctctccctgcacctgaaccg
aaaccaaagcccgaaccagaggtgaaaataatcaaaccacctccagtggagcctgcacca
acccccatcgcagccccagtaaccgtgccagtagttggaaagaaagcagaagccaaagca
cccaaagaggaggctgccaagccgaaaggtcccatcaaaggtgtagccaaaaagactcct
tcaccaatagaacttgaaaagaaaaagttgagaccaggaagtggtggggagaaacctcct
gatgaagccccgttcacctaccagctgaaggctgtgccactgaagtttgtgaaagaaatc
aaagacatcgtcttgaccgaagcagagtcagttggctcttctgcaatttttgaatgtcta
gtctctccctctactgccattacaagctggatgaaagatggtagcaatatccgtgagagc
cccaaacacagattcatcgcagatggtaaagacagaaagctgcatatcattgatgttcag
ctttctgatgctggcgaatacacctgcgttttacgtttgggaaataaagaaaagacctcc
acggcaaaacttattgtagaagaacttcctgtgcgctttgtgaaaacgcttgaagaggaa
gtcacagtggtcaaaggacagccattgtacttgagctgcgagttaaacaaagagcgcgat
gtggtctggaggaaggatgggaagattgtggtggagaagcctggcaaaattgtgcctggc
gtcattggcttgatgcgggccctgactatcaatgatgcagatgacactgacgccggaacg
tacacagttactgtggaaaacgccaacaacctggaatgttcatcttgcgtaaaagtcgta
gaagtcattagagactggctggtgaaacccatacgagatcagcatgtgaaacccaagggg
acagctgttttcagctgtcatatagcaaaggatactccaaacattaagtggttcaaagga
tatgatgaaatcccctgggaaccaaatgataagactgagatagtgaaagatggaaatcat
ctatacctcaaaattaagaatgccacaccagaagatattgatgaatatgcagtggaaatt
gaagggaaaagatatcctgcaaagctaacacttggagaccgcgaagttgaattgcttaaa
ccaatagaggatgttaccatttatgagaaagaaagtgcaagctttgatgcagaaatctca
gaggcagacattcctggacaatggaaactgaagggagaactcctaaggccttcacctact
tgtgaaatcaaagcagaaggtgggaaacgcttcttaactttgcacaaagtcaaactggac
caagctggtgaagtcctttaccaggccctcaatgcaattacgacggccattctgacagta
aaagaaatcgaacttgactttgctgtgcccctgaaggatgtcactgttccagaaaagcga
caggctcgatttgaatgtgtcctcacccgagaggcaaacgttatatggtctaaagggcct
gatattatcaagtcatctgacaagtttgatatcattactgatggaaagaaacacattctt
gtcatcaataattctcaatttgatgacgaaggggtctataccgcttcggtggagggcaag
acgacctcagcacgattatttgttacaggtataagattgaagttcatatcgcctcttgaa
gatcaaacagtgaaagaaggtgaaacagcaacttttgtttgtgagctttctcatgaaaaa
atgcatgtagtctggttcaaaaatgatgtcaaactccacacgagcagaactgtactcatc
tcatctgagggcaaaactcacaaattggaaatgagagaagtgaccctggatgatatatcc
cagataaaagctcaagtgaaggacctgagctccacagcaaacctaaaggtcttagaggcc
gatccctacttcactgtgaaattacatgacaaaactggagtcgagaaggatgagattatt
ctgaagtgtgaagtgagcaaagatgtgccagtgaaatggttcaaagatggcgaagagatt
gaaccttcacccaaatactccatcaagtcagacggcctgcgccgcatcttaaaaatcaaa
aaggcagaacttaaagataaaggcgaatatgtgtgtgactgtggcactgacaagacaaca
gcaaatgttaatgttgaggctcgactaataaaagtggaaaaacctctgcgtggagtagaa
ttgtttgttggtgaaacagctcgctttgaaattgagctttctgaaccagatgttcatggc
cagtggaagttaaaaggagagcctttaactgcttcccctgactgtgaaatcattgaagat
gggaagaagcatattctggtcctttataactgccagctggatatgacaggagaggtctcc
ttccaggctgccaatgctaaatctgcagccaaactgaaagtgaaagaattgccacttatc
ttcatcacacctctcagtgatgttaaagtctttgagaaagatgaggctaagtttgagtgc
gaagtatccagggaacccaaaacattccgttggctgaaaggaacccaagaaatcacaggt
gatgacaaaattgagcttataaaggatggcactaagcattcaatggtgatcaaatcagct
gcttttgaagatgaagcaaaatacatctttgaagctgaagataagcacacaagtggcaaa
ctgatcattgaaggaatccggctcaaattcctcaccccactcaaggatgtaacagccaag
gagcgggaaagtgccgtgtttactgtggagctgtcccatgataacatccgcgtcaagtgg
ttcaaaaacgaccagcgcctgcacaccaccaagttggtctcaatggaagatgaagggaag
attcattccatcacattcaaaaacctctctattgatgacacctctcaaattaaagtagaa
gctatggggatgagttcagaagctaaactcactgtgcttgagggagatccatactttaca
ggaaagcttcaagattacactggcgtagagaaagatgaagtggttctacagtgtgaaatt
agcaaagcagatgcaccggtgaagtggtttaaggatggggaggaaataaagccatccaaa
aatgctattattaaggcagatggcaagaagcgcatgctaatactgaagaaagccttaaag
tcagatattggacagtacacctgcgactgtgggacagacaagacctcaggaaagcttgac
attgaggatcgggaaattaaactggtgcgacccctgtacagtgtggaggtgatggagact
gagacggcccgctttgaaaccgaaatctcggaagatgatatccatgccaactggaaactc
aagggagaggcactgctccaaacacctgactgtgagatcaaggaagaaggcaaaacgcac
ttcctaattttgcacaactgccgcctggaccaggccggtggggtggatttccaagctgcc
aatgttaaatctagtgcccacctccgagtaaaaccacgagtaattggtcttctgaggccc
ctgaaggatgtcacggtgactgcaggggaaacagccactttcgactgcgagctctcttat
gaggatatcccagtggaatggtatctcaaagggaagaaactggagcccagcgataaggtg
gtcacacgttcggaaggaagagttcacacacttactctgagggatgtaaagttagaagat
gctggagaagtccaactaacagcaaaagatttcaaaactcaagccaaactctttgtgaaa
gaacccccagttgaattcactaagcctcttgaggaccagacggtcgaagaggaagccact
gcggtattggagtgtgaagtatccagagaaaatgcaaaggtgaaatggttcaaaaatggg
acagaaattctcaaaagcaagaagtatgaaattgttgctgatggcagggtcagaaaactt
attatacatggctgtaccccagaggatattaaaacatacacttgtgatgctaaggatttt
aagacttcctgtaacctgaatgtcgtgcctccgcacgtggaattcttaagaccactcacc
gatcttcgagttaaagaaaaagaaatggctcgatttgagtgtgaactctcccgagaaaat
gccaaggttcactggttcaaagatggtgctgaaattaaaaagggcaaaaaatatgatatt
atatctaagggagctgtgcgcattctggtcatcaacaaatgtctacttgatgatgaagca
gaatattcctgtgaagtaaggacagcaagaacttctggcatgctgacagtagtggaagaa
gaagctgtctttaccaaaaatcttaccaacgttgacgttagtgaaacagacactataaaa
ctggtttgtgaagtctccaagcctggagcagaagtgacttggtacaaaggggatgaagag
atcattgaaacaggaagatatgaaatacttactgatgggcgaaagagaatcctgatcatt
cagaacgctcaccttgaggatactggcaactacaactgccgactcccaagttctcgaact
gatggcaaagtcaaagtacatgaacttgctgctgaatttatctcaaagcctcaaaacctt
gaaatacttgaaggagaaaaggctgaatttgtctgctctatatcaaaggaaagctttgaa
gtccaatggaagagagacgataagacacttgaatctggagataaatatgacgttattgct
gatggcaaaaagaggatcctagttgtgaaagatgccacattacaagatatgggcacttac
gtagtcatggttggggccgccagagcagcagctcacttgacagtaattgaaaaactcagg
atcatagttcctcttaaggacacccgtgtgaaggaacaacaagaagtcatcttcaactgt
gaagtcaatactgaaggtgccaaagccaaatggttcagaaatgatgaagccatatttgat
agttcaaaatacattattctccaaaaagacctggtctacaccctcaggattagagatgca
cgattagatgatcaagccaactatagtgtgtctctgaccaatcatagaggtgaaaatgtt
aagagtgcagccaatctaatagtagaagaggaagaccttaggattgttgagcctcttaaa
gatattgaaacaatggagaagaaatctgtcacattctggtgcaaggtgaatcgtctcaat
gtaacactaaagtggaccaaaaatggagaagaggtggcttttgacaaccgtgttttatac
agaattgataaatataagcactctctaatcattaaagactgtggcttcccagatgagggt
gaatacatcgtcactgctggacaagataaatctgttgctgagcttcttatcatagaagcc
cctacagaatttgtggaacacttggaagaccagacagtcactgagtttgatgatgctgtc
ttctcctgccagctctccagagagaaagcaaatgtaaaatggtacagaaatgggagggaa
atcaaagaaggcaaaaaatacaaatttgaaaaagatggaagtgtacatcgactcattata
aaagattgcaggctggatgatgaatgtgaatatgcttgtggagtggacgacaggaagtct
cgagctagactttttgtggaagaaatccctgttgagatcatcaggcctccccaagatatt
cttgaagctcctggtactgatgttgtcttttgggctgagctcaacaaagataaggtggaa
gtccaatggctaaaaaataacatgattattgtccagggtgacaaacaccaaatgatgagt
gaaggaaagatacacaggctacagatttgtgacattaggccacgtgaccagggtgaatac
agatttattgctaaagacaaagaagccagagctaagcttgaactggcagctgcacctaaa
atcaagacagctgatcaagatcttgtggttgatgttggccagcctctgacaatggtggtg
ccctatgatgcctaccccaaagcagaagctgagtggtttaaagaaaatgaagctctgtct
tcaaaaactgttgatactacagctgaaaaaacttctttcagaattttagaagccaagaaa
ggagacaaaggaaggtataaaattgtgcttcagaacaaacatggaaaagcagaagccttc
atcaatttacaagttattgatgttcctgggccagtacgtaacttagaagtgacagaaaca
cttgatggtgaagtgagcctcgcttgggaagaaccattaactgatggtggaagcaaaatc
ataggttatgttgttgaaagacgtgacatcaagagaaagacctgggttctggccactgac
cgtgcagacagttgtgagtttactgtcactggactacaaaaaggaggagttgaataccta
ttccgtgtgagtgcaagaaacagagttggcactggtgaaccagtagaaactgccaatcct
gtggaagcaaggagtagatatgacgttccaggccctcctttgaatgtgaccatcacagat
gtgaatagatttggtgtctcactgacatgggaaccaccagagtatgatggaggggctgag
atcacaaattacatcattgaattaagagacaaaacttctatcagatgggacactgccatg
acagtaaaagctgaagacttgtctgcaactgtcactgatgtggtggaaggacaggagtat
agtttccgggtcagagcccaaaaccgaattggagttggaaaaccaagtgcagccacacct
ttcgtcaaagttgctgatccaattgagagaccaagtcctcctgtgaacctaagttcctca
gatcagactcagtcatcagttcagctcacatgggaacctcctctgaaagatggaggaagc
ccaatattgggctacataattgagcgatgtgaagaaggaaaagatgagtggattcgttgc
aataagaaacttgtccctgaactgacttacaaggttactggattacaaaaaggaaataaa
tatttatatcgagtatctgcagaaaatgaagctggtgtttcagatccatctgaaattctt
ggtcctctaactgctgatgatgcatttgttgaaccaacaatggatttaagttcgtttaaa
gatggtctggaagttattgtcccgaaccctatcaagatcctggttccaagtacaggctat
ccaaggccaactgcaacctgggcgtttggagataaagtactagaagcaggggaccgtgtg
aaaatgaaaaccttatctgcctatgctgaactggtcatttctccaagtgaacgtccagac
aagggcatttatacactgaaattagaaaatcgtgtgaaagcaatttctggggaaattgat
gtcaatgtaattgctcgcccaagtgcacccaaagaactgaaatttgatgacataaccagg
gactcagtacatttgacttgggaaccaccagatgatgatggaggaagtccattaactgga
tatcttgttgaaaagcgagaagtcaaccggaaaacatggactaaagttatagactctgtg
actgacctagaattcacagttcctgatcttgttcaaggaaaagaatatttatttaaagtc
tgtgctcgtaacaagtgtggccctggagaacctgcatatgttgatgaacctgtaaatatg
tcagctcctgcaacggtacctgacccaccagagaatgttaaatggagagatcgaacagcc
aagagcatcttcctaacatgggatccacctaaatatgatgggggttcacgcatcaaagga
tatatagttgaaaaatgtccacgtggttctgatcgatgggtcgcctgtggggaaccagtt
gcagaaacaaaaatggaagtgacaggccttgacgaaggccagtggtattcctaccgtgtg
aaggccttgaataggcaaggtgccagcaaaccaagcaagcccacagatgaaatccaggct
gtggacgcacaggaggctccagaaattttcctcgacgtgaagctccttgctggtctcact
gtaaaggcaggaactaagattgaacttcctgccactgtcactggaaaacctgaacctaca
ataacttggacgaaggctgacatgcttctgaagcaggacaaaagaatcaccattgaaaat
gttcctaaaaaatccactgtgactatcgtcgatagcaagagaagtgacactggcagatac
attatcgaggctgtgaacgtctgtggtcgggccactgccgtggcagaagtgaacgtctta
gataaacctggaccaccagctgcttttgacatcacagaagtgaccaacgagtcatgtctt
ctaacatggaacccaccacgagatgatggtggatctaaaatcacaaactatgttgtggag
agaagagcagctgacagtgatatgtggcacaagctctcatcaactgtcaaggatacaaaa
ttcaaggcaaccaacttaatccccaataaagaatacctcttcagagttgctgcagaaaac
atgtatggtgttggtgaaccagttcaggccactccaataacagccaaatatcagtttgat
ccacctggacctccaactcgccttgaaccttctgatatcactaaagatgcagtgactctc
acatggtgtgagccagatgatgatggtggcagcccaatcactggatattgggttgaaaga
ttagatcctgatactgataaatgggttaggtgcaataagatgccagtaaaggacacaaca
tacagagtgaaagggctcaccaataagaaaaagtacagattccgtgtgttggctgaaaat
cttgctggacctggaaaaccaagtcgatcaacagaaccgatcttaataaaggatcccata
gatcctccatggccccctggaaaaccaactgtgaaagatataggcaaaacatcaataatg
ttgaattggacaaagccagaacatgatggaggggcaaagattgagtcttacgtcattgaa
atgctaaagactggaacagaggactgggtccgagtggctgaaggggttcccaccactcag
catttgctcccggggctcatggaaggtcaggaatactcattccgagttagagctgtgaac
aaggccggggaaagtgaacccagcgaacccagtgaccctgtgctttgccgggagaagcta
tatcctccatcaccacctcgctggcttgaagttattaatatcacaaaaaatacagcagac
ctaaagtggacagttcctgagaaagatggagggtcccccatcaccaactacatcgtggaa
aagagagatgtgaggcgaaaaggctggcaaacggtggacacgactgtcaaggacaccaag
tgcacagtaaccccactgacagagggctccttatatgtgttccgagtcgctgcagaaaat
gccataggacaaagcgactactgtgaagtcgaggactccgtcctggccaaagacactttc
accacacctggaccaccctatgctctgactgtggttgatgtgacgaaacgacatgttgac
ctgaagtgggaaccacctaaaaatgatggtggaagaccaatacagagatatgtcattgag
aagaaagaaaagttaggcacccgttgggtgaaagctggaaagacctcagggcccgactgt
aacttcagagtaactgatgtcattgaaggaacagaggtccagtttcaggttcgggcagaa
aatgaagctggagttggtcatccaagtgaacccacggaaatcctgtcaattgaagatcca
acaagtcctccttcacctccccttgacctgcatgtgactgatgctgggagaaagcacatt
gccattgcttggaagcctccagagaaaaatggtggaagccctattataggataccatgtt
gaaatgtgtccagtaggcactgaaaaatggatgcgagttaattctcgcccaataaaagac
ttgaaattcaaggttgaagaaggcgttgttcctgacaaggaatatgttctgagagtgaga
gctgtcaatgctgttggtgtcagtgagccatctgaaatctccgaaaatgtggttgccaaa
gacccagattgcaagccaacaattgatctggagactcacgacattgttgttattgaaggt
gaaaagttaagtattcctgttcccttcagagctgtcccagttccaaccgttagttggcat
aaagatggcaaagaagttaaagcaagtgatagattaacaatgaagagcgatcacatctct
gcacacctcgaagttcccaagagtgtccatgcagatgctggagtttacaccattacactg
gagaataagcttggctcagcaactggctcaatcaatgtcaaagtcataggcctacctgga
ccatgcaaagatattaaagcaagcgacgtgaccaagagttcttgtaaattaacctgggaa
cctccagaatatgatggtggaagcccaattcttcattatgtcctggaacgcagagaagct
gggaggaggacatatataccagtcatgtctggtgagaacaaactgtcctggactgtaaaa
gatctcataccaaatggcgaatacttcttccgtgttaaggctgtcaacaagattggtgga
ggcgaatatattgaactgaaaaatccagtcattgctcaagatccaaagcagccccctgat
ccacctgtagatgttgaggttcataatcctacagcagaggcaatgactattacatggaag
ccacctttgtatgatggagggagcaagataatgggttacatcatagagaagattgctaag
ggtgaagagagatggaagagatgcaatgaacacctggtaccagtcctgacctatacagca
aaaggactcgaagagggaaaggaataccagttccgtgtgcgagcagaaaatgctgccggt
atcagtgaaccttctcgggccactcctccaaccaaagctgtagatcctattgatgcccca
aaagtcattctgagatcaagcctagaagtgagacgaggtgatgaaatagcactcgatgca
actatttctgggtcaccttacccaactattacatggataaaggatgaagaaattattaca
ccagaggaaattaagaagcgagtagcacccatggttaggaggaggaggggtgaagttcaa
gaagaagaaccatttgtcctgtctctgacggagcgtttgagcattgacaatagtaaaaaa
ggagaatctcaactacgcgtccgagattctattcgacctgaccatggccaatatatgatc
aaagctgaaaatgaccatggtattgcaaaagctccttgcactgtcagtgtgctagataca
ccaggaccaccgatcaacttcgtatttgaagatgttagaaagaactcagttgtctgtaaa
tgggaaccaccccttgatgatggtggcagtgaaattataaactacactttggaaaagaaa
gacaagacaaaacctgactccgaatggattgttgtcacttcaacacttagacattgcaaa
tatccagtgacaaagctgattgaaggaaaagagtacctcttccgtgtaagagcggaaaat
aggtttggacctggaccaccatgtgtttcaaagccacttatagctaaagatccatttgaa
ccacctgatgcacctgataagcctattgtggaagatgttaccagcaacagtatgctagtg
acatggaatgaaccaaaagataatggaagccccatcttaggttactggcttgaaaaacgt
gaggttaatagtacacattggtcccgtgtcaacagaaaccttctcaattctttgaagacc
aatgtagaaggcctattagagggactcacctatgtcttcagagtatgtgccgaaaacgca
gctggacctggaaagttcagtcccccttcagatcccaaaacagcacgtgatccaatcgct
ccacctgggccacctgtcccaagagtcgctgacacaagctctacaaccattgaactcgaa
tgggaacccccagctttcaatggtggtggggaaattattggttactttgtcgataagcag
ctggttggcacaaatgaatggtcacgctgcacagagaagatgatcaaggcccgtcagtac
accgtcagagaaatccgagagggtgctgattacaaacttcgagtgagtgctgtcaatgct
gcaggtgaaggaccacctggagagacagaacctgttactgtggctgaaccaaaagagcct
cccactgtggaactagatgtttctgtcaaggctggaatacaaataatggctgggaagact
cttagaattccagctgtggtaactggtcgtccagtgcctacaagagtatggacaatagaa
gaaggggagctggataaagaccgtgttgtaatagagaatgttggaaccaaatctgaacta
attatcaagaatgcattgagaaaagatcatggcagatatgtgattacagctaccaatagc
tgtggttccaaatttgcagccaccagggtagaagtttttgatgtccctggtccagttctt
gacttaaaacctgttgtaacaaacagaaagatgtgtctgcttaactggtctgatccagaa
gatgatggaggaagtgacatcacgggctttattattgaaagaaaagatgctaagatgcat
acttggagacaaccaatagagactgacagatctaaatgtgacatcacaggtctccttgag
ggacaagaatatatgttccgtgtgattgccaagaacaagtttggctgtggccctcctgtt
gaaataggaccaattcttgcagttgatccactaggtcctccaacgtctcctgagaggctc
acatatacagaaaggacgaagtccactatcaccctggactggaaagagccccgtaacaat
ggtggcagccccatccaaggctacatcattgaaaaacggcgtcacgataaacctgacttt
gaaagagttaacacgcgactctgcccaaccacatcttttctggttgaaaatcttgacgaa
caccaaatgtatgaattccgtgtcaaagccgtcaatgaaattggtgaaagtgaaccatcc
ttgcctcttaatgtggtcatacaagatgatgaagtgcctccaactattaagttgcgcctg
gctgttcgaggagacactatcaaagttaaggcaggagagcctgttaacatccccgcagat
gtgacaggccttccaatgcctaagattgagtggtccaagaatgaaactgtgattgaaaaa
cccactgacgcacttaagataacaaaggaagaagtatcccgaagtgaggcaaagactgag
cttagcattcccaaagcagtccgggcagacaaaggcacttacacagttactgcttccaat
cgccttggctcagtgttccgaaatgttcacgttgaagtatatgatcgtccatccccacca
agaaatcttgctgttactgacattaaagctgaatcttgctacttgacttgggatgctcct
ctagacaatggtggcagtgaaattacccattatgtcattgacaaacgtgatgcaagtagg
aagaagagtgaatgggaggaagtcaccaacactgctgtagagaagagatatgggatctgg
aaacttatccccaatggtcagtatgagttccgagtaagggcagtgaataaatatggaatc
agtgatgactgcaaatcagataaggtggtcattcaagatccttatcgcccacctggacct
ccgggaaaaccaaaagtcttggagcgcaccaaagggtcgatgctagtgagctggactcct
cctttggacaatggcggctctccaattactggctactggctggagaagagagaagaggga
ggtgcctactggtcacgtgttagccgagcaccaataactaaaacgggattgaaaggcgtg
gaatttaatgttcctcgtttgattgaaggcgttaaataccagttcagagcaatggcaata
aatgctgcaggagttggccctcccagtgaaccatcagatccggctgttgcaggagatcct
atatacccacctgggccaccttcttgcccagaggtcaaagataaaacaaagtcaagcatc
tcgctagcatggaaacctccagccaaagatggtggcagtcccatcaaaggatacattgta
gaaatgcaagaggaaggtactactgactggaaaaaagtaaatgaaccagacaaacttcta
actacctgtgaatgtgtggtgccgaatttgaaagaactcaggaagtacagattcagagta
aaagctgtcaatgaagctggtgaatctgaaccaagtgatacaactggagagatccctgcc
actgatattctagaggtaccagaagttttcattgacattggagcacaggactgtctgatt
tgtaaagctggctcacagattaggattcctgctgtcatcaagggacgcccaacaccaaaa
tcatcttgggaatttgatggaaaggcaaagaaggcattgaaggatggagttcatgacata
cctgaagatgcacagctggagactgctgaaaactcatcagtaattattattccggagtgt
aaacgatctcattcaggcaaatacagcatcacagccaagaataaagcaggacaaaagact
gcaaattgcagagttaaagtcatggatgtaccaggcccacccaaagatctgaaagtcagt
gacatcacaaggggtagttgcagactttcatggaagatgccagatgacgatggaggagac
aggatcaagggttatgttattgagaagaagactattgatggaaaagcctggactaaagtc
aatccaaactgtggaagcaccacatttgtgattcctgatctcatctctgaacagcagtat
ttcttccgcgtgcgtgcagaaaaccgttttggtattggtgcacctgtggaaaccattcag
aggaccactgccagagatccaatatatcctcctgatccccctattaaactcaagattggc
ctcataacaaagaacacagtacacctgtcatggaaacccccaaagaatgatgggggctcc
cctgtcacccactatattgttgagtgtcttgcatgggaccctactgggaaaaagaaagaa
gcatggaaacagtgcaataagcgtgatgtggaagaactggaatttactgtggaagacctc
gtggagggaggggaatatgaattcagagtcaaagctgtcaatgctgccggagtcagcaaa
ccttcagaaactgtgggccctgtgattgtcaaagatcagacatgcccaccatcaattgag
ctcaaagaatttatggaggttgaagaaggaactgatgtcaacatagtggccaaaattaaa
ggtgtgccattcccaacactaacctggtttaaagcgcctccaaagaagcctgataacaaa
gaacctgttgtctatgacacccacgtcaacaaagtggtggtggatgatacttgcacctta
gttattccacagtctcgccggagtgacactggcttatatactatcacagccgtgaataac
ctgggaacagcatcaaaggagatgagactgaatgtccttggtcgtcccggccctccagtg
ggacccataaagtttgaatctatttcagcagatcaaatgacaatatcttggcttccacct
aaagatgacggtgggtctaagattacaaactatgtaattgagaaaagagaacctaacagg
aagacctgggtgcacgtcaccagtgaacccacagagtgcatgcacacaattcccaaattg
cttgaaggccatgaatatgtattccgaatcatggcccagaataaatatggcattggcgag
cctcttgacagtgaacctgaaacagcaagaaacctcttttctgtccctggagcaccagat
aaaccaacagttagcagcgtgactcgtaattccatgactgtcaactgggaagagccagaa
tatgatggaggctctcctgtgacaggatactggctagaaatgaaagataccacttcaaag
agatggaagagagttaatcgagatcctattaaagccatgactttgggtgtttcttataaa
gtgactggtcttatcgaaggttctgattatcaattccgggtatatgcgatcaatgctgct
ggggtgggtccagcaagtctgccatcagacccagtgactgctagagatccaattgcccct
cctggtcctccatttcccaaggtcacagactggactaaatcaactgcggatttggagtgg
tctcctccactaaaagatggtggatccagagtaactggatacattgttgaatataaagaa
gaaggaaaagaagaatgggaaaaggctaaagataaagaagtgagaggaacaaaacttgtt
gtgacaggattaaaagaaggagcattctacaaatttagagttagagcagtcaacattgct
ggcattggagaacctggagaagttacagatgccattgaaatgaaggacagacttgtgtta
cctgacgttcagctggatgccagcgtcagagacagaattgtggtccatgctggaggagtg
atccggatcatcgcctatgtgtctggaaagcctcctccaacgatcacatggaacatgaat
gaaagagccttacctcaagaagccaacattgagaccacagccattagctcatccatggtc
atcaagaattgccagaggagccaccaaggcgtctattctcttcttgccaaaaatgcggca
ggagaaagaaagaagaccattatcgttgacgtattagatgtgccaggtcctgttggaata
ccattcctgcctcacaacctaaccaatgactcctgcaaactgacatggttttctccagaa
gatgatggaggctctccaatcaccaattacgtcattgaaaagcgggaagctgaccgcaaa
gcatggacaccagtgacatgtacagttacccgacaaaatgctaccgtccagggtctcatt
caaggaaaagcctactttttccgaattgcagctgaaaatagcattggcatgggcccattt
gttgagacaacagaggaacttgtcatcagagatccaataactgtaccagagcgtcctgaa
gacctggaagtcaaagaagttactaaagattctgttactttgacttggaatcctcctaag
tatgatggcggatcagaaattattaactatgtcctagaaagccgtctcattggaactgag
aagttccacaaagttacaagtgacaacttgcttagcagaaagtacactgttaaaggctta
aaagaaggtgatacctatgagtaccgtgtcagtgccgtcaatattgttggacaaggcaaa
ccatccttttgcaccaagccaatcacttgcaaggatgagctggctcctccaacccttgac
cttgacttcagagataagctcacaattcgagttggtgaagcttttgccctcactggccgt
tactcaggcaaaccaaagcctaaggttacttggttcaaagatgaagctgacgtgctagaa
gatgaccgcactcaaataaagaccactccaacaacacttgctctagagaagatcaaggcc
aaacgttctgattctggcaaatactgtgtggttgtggagaacagtacaggctctaggaaa
ggtttctgtcaagttaatgttgttgatcgtcctggaccaccagtaggaccggttattttt
gatgaggtaaccaaagatcacatgattatctcttggaagccacctttagatgatggaggc
agtgaaattaccaattatattattgagaagaaggaggtgggcaaagacgtttggatgccg
gtgacatctgcatgtgctaaaacaacatgcaaagttcctaaactgcttgaaggaaaagat
tatattttccgtatacacgccgaaaatttgtatggaataagtgatcctctggtgtctgat
tcaatgaaagccaaagatcgtttcagggttcctgatgcacctgaccagccaattgttaca
gaagttaccaaagactctgcattagttacatggaacaagccaaatgatggaggaaagccc
atcacaaactacatcctggaaaagagggaaactatgactaaacgatgggttcgagttacc
aaagagcctatccacccatacactaaatttagggttcctgaccttctagaagggtgttac
tatgaattccgagtttctgcagaaaatgaaattggtattggagacccaagcccaccatcc
aaaccagtctgtgctaaagatccaattgctaaaccaagcccacctgttaatcctgaagca
atagatacaacatgtaattcagttgatctaacttggcagccaccacgtcatgatggtggg
agcaagattctgggttatattgttgagtaccagaaagttggagatgaagagtggaaaaga
gccaatcacactcctgagtcatgtcctgaaactaaatataaagtcactggtctccgggat
ggtcaaagctataagttcagaattagagcagtcaatgaagctggtgaatcggacccagct
catgttccggagccagtgctagtaaaagacagacttgaaccccctgagttgattcttgat
gccaacatggcaagagaacaacacataagggttggtgatactctaagacttagtgccgtc
atcaaaggagtgccattcccaaaagtaacttggaaaaaagaagacagagaggctccaact
aaagcaagaattgatgttactccagttggtagcaagcttgaaattcgtaatgctgcccat
gaagatggtggaatttattccttaacagtggagaatccagctggttcaaaaactgtctca
gtaaaagtacttgtattagataagcctggaccacctagagatctggaagtcagtgaaatc
agaaaagattcttgctacctcacttggaaggaaccattggatgatggtggttctgttgtt
acaaattatgtggttgagaggagagatgttgccagcgcccagtggtcacctctttcaact
acatcaaagaaaaagagtcacttggctaagcatcttaatgaaggcagtcagtatctcttc
cgagtagctgctgagaaccagtatggacgtggtccttttgttgaaacacctaaacccatc
aaggctgtggatcccctacatcccccagggccaccgaagaacctacaccacgtagacgtt
gacaagaatgaagtctcccttgtttggaataagccagatcgtgatggtggttctccaatc
actggatatttggtggaatatcaagaagagggcaccgaagattggattaagttcaagact
gtgacaaacttagagtgtgttgttactggactacaacaaggaaaaacctataaattccgt
gtaaaagctgaaaatattgtgggtcttagtctccctgatacaactatcccaatagaatgt
caagaaaaactagtgcctccatctgtggaactggatgtgaaattaattgaaggccttgtg
gtaaaagctggaactacagtcagattccctgccattataaggggtgtacctgttcctact
gcaaagtggacaaccgatgggagtgagattaaaacagatgatcactacacagttgaaact
gacagctactcatcagtgcttaccattaagaactgcttaaggaaagacactggggaatat
caaatcacagtttccaatgcagctggcagcaaaacagtagccgtccatcttactgttctt
gatgttcctggtccaccaacaggtcctattaatattctggaagttacccctgaacatatg
actatctcatggcagccacctaaggatgatggaggaagccctgtgataaattatatcgtt
gagaaaaaagatacaaggaaagacacgtggggtgttgtctcttcaggaagcagtaagaca
aagctgaaagtcccacatctacaaaagggttttgaatatgtcttccgagttagagcagag
aataagatgggtgttggtcctccccttgactccgtacctactgttgctaaacacaagttt
agtcctccatctcctcctggtaaaccagtggttactgacataactgaaaatgctgcaaca
gtgtcttggactctgcctaaatctgatggtggcagtcctataactggttactatgtggaa
cgtcgagaaataactggcaaatgggtgagggtcaacaaaacacctataactgagctgaag
tatacagtgactggactctatgacggaaatacatatgagtttagagtttttgctgaaaat
cttgcaggactaagcagtccatccccaagttctgacccaataaaagcttgccgacccatc
aaaccacctggaccacctattaatcctaaactgaaagacaagaccagagaaacagctgac
ttggtgtggacaaagcctctcagtgacggtggtagccccattctaggctatgtagtggaa
tgtcagaaacctggtacagcacaatggaacaggattaataaagatgaactcattaggcaa
tgtgcctttagggtacctggtctaattgaaggaaatgaatacagattccgtataaaggca
gctaatattgtgggggagggagagccaagagaactagcagaatctgtgattgcaaaagac
atccttcatcctccagaagtagaacttgatgttacttgtcgtgatgttattactgttaga
gtgggccaaactatccgcattcttgctcgagtcaaaggcagacctgaaccagacataact
tggtccaaggaaggcaaagcattggtccgagaaaagcgagttgacataattcacgatctg
cctcgtgctgagttacaaattaaagaagctattagagctgatcatggcaagtatatcatc
tcagctaagaacagcagtggacatgcccaaggttccactatcgttaatgtccttgacaga
cccgggccttgccagaatttaagggttagcaatgtaactaaagagaactgtacgattgct
tgggaaaacccactagataatggtggctcagaaataacaaatttcatagtagaataccgc
aaacccaacgagaaaggctggtcaattgttgcttcagatgtcactaagcgattaatcaag
gccaaccttttagccaacaatgaatactatttccgagtttgtgcagagaataaagtaggt
gttgggccaaccattgaaacaaaaactccaattctggctattaaccctattgatagacca
ggtgagcctgaaaaccttcatattgcagacaaaggaaagacatttgtctatctaaagtgg
cggcggcctgactatgacggtggtagcccaaatctatcatatcatgttgagaggaggctg
aagggctctgcagactgggaaagagtgcacaaaggcagcattaaagaaacccactacatg
gttgacaagtgtgttgaaaaccagatttatgagtttagagtgcaaacaaagaatgaaggt
ggggaaagtgactgggtaaagacagaggaagttgtcgtgaaggaagacttacagaaacca
gtacttgagctgaaattaagtggtgtgctaactgtcaaagcaggggacaccattagactt
gaggcaggtgttagaggcaaaccatttccagaagttttatggaccaaggataaagatgct
acggacttaacaagatcaccgagggtcaagattgataccagtgctgattcatctagattt
tctcttaccaaagcaaagcgaagtgatggtggtaaatatgtaattacagcaactaacaca
gctggcagttttgtggcctatgccactgtcaatgttctagataagcctggtcctgtaaga
aatctgaaaattactgatgtgtccagtgataggtgtactatttgctgggatccaccagaa
gatgacggcggctgtgaaatccaaaattatattctagaaaaatgtgagagtaagcgaatg
gtttggtctacctattctgctactgtcttaacaactggtgctacagtaacacgcctcata
gaaggaaatgaatacattttcagagtccgtgcagaaaataaaataggcacagggcctcca
acggaaagtaaaccggtcattgcaaaaaccaaatatgatagacctggtcgccctgatccc
ccagaagtcactaaagtaagcaaagaagagatgactgtggtttggactccacctgaatat
gatggtgggaagtccatcacaggatactttttggagaaaaaggaaaaacatggaacacga
tgggtccctgttaacaagagtgcaatccccgagagacgtctgaaagtacagaatctcctc
ccaggacatgaatatcagttccgtgtcaaggcagaaaatgaaattggaattggagaacca
agcttgccatcaaaaccagtagtggcaaaagaccccatagaaccacctggtccaccaacc
aatctcaaagtggttgatacgaccaaaagttctataacccttgcatggggaaaaccggtg
tatgatggtggcgcgccgataattggatatgttgtggaaatgagaccaaaaagaccagat
atgtcacctgatgaaggctggaaaagatgtaatgcggcagcacagcttgttcgcatggaa
ttcactgtcaccagcttggatgaaaaccaggaatacgagttcagggtgtgtgcccaaaac
caggttggcattgggcgccctgcagaactaaaggatgctattaaacctaaagaaatccta
gaacctccggagattgatttggatgccagcatgagaaaactggtcacagtgagagcagga
tgccctattcgactatttgccataataagagggcgaccagcccctaaagtcacttggcga
aaagtgggtatcgataatgtcgtcagaaaaggacaagtcgatctggttgacactatggcc
ttccttgtcatccccaattctacccgtgatgactcaggaaaatattccttgacgcttgta
aacccggcaggagaaaaggcagtgtttgtgaacgtcagagtattagatactcctggacct
gtgtctgatttaaaagtttcagatgtcactaaaacatcatgccacatttcctggggccct
cctgagaacgatggtgggagccaagtgacacattatattgtggagaaacgtgaggccgac
agaaagacatggtcaactgttaccccggaagttaagaaaacaagcttccaagtcaccaat
cttgtccctgggaatgagtatttcttcagagtaactgctgtcaatgagtatggccctggt
gtcccaacagacgtccccaaaccagtgcttgcatctgatccgctctgtgagccggatccc
ccaaggaaactagaagtgactgaaatgacaaagaacagcgctgcattagcctggttacca
cccttgcgtgatggaggcgctaagatcgatggctatatcattagttacagagaagaagag
cagcctgcagatcgctggacggagtactcagtggtgaaagacctcagccttgttgtcact
ggcctaaaggaaggaaagaaatataaatttagagtagtggccagaaatgctgttggagtc
agtttgccaagagaaactgaaggagtgtacgaagcgaaagaacagctgttgccaccaaag
atccttatgccagagcaaattactatcaaagctgggaagaaactccgaattgaagcccat
gtgtatggaaagcctcatccgacctgtaaatggaaaaaaggagaagatgaagttgtcaca
tccagccacttggcagtgcataaagcagacaattcttcaattctgatcataaaagatgtt
actaggaaagacagtggttactatagcctcacagcagagaacagttctggaacagacact
cagaaaatcaaagtcattgtcatggatgctcccgggcctcctcagcctccatttgacatt
tctgacatagacgctgatgcttgcaccctgtcgtggcacatccctctggaggatggaggc
agtagcatcaccaattacatagtggagaagtgtgacgtgagccgaggtgattgggtgaca
gctctagcttcagtgacaaaaacttcctgcagagttggaaaactgatccccgggcaggag
tacatcttccgagtccgtgctgaaaatcgattcggcatttcagagcctctcacatctcca
aagatgctggctaagttcccatttggtgttcctagtgaaccaaagaatgcacgagtcact
aaagtcaacaaagactgcatatttgtggcatgggacagaccagacagtgatggagggagc
cccattaccggttacctgattgaacgcaaagaaagaaacagtttgctctgggtgaaagct
aatgatactcctgtccggtcaactgaatatccttgtgcaggccttgtagaaggtcttgag
tattcattcagaatatatgccctaaacaaagctggatccagcccacctagcaaaccaaca
gaatatgtaactgcaagaatgccggttgatcctcctggaaagcctgaagttattgatgtt
accaagaatacggtatcccttatctgggctcgtccaaagcatgatggaggcagcaaaatt
attggctatttcgtagaagcttgcaagcttcctggtgataagtgggtacggtgcaatact
acacctcaccagattccccaggaagagtacacagttactggcttagaagagaatgctcag
tatcaatttagagcaattgccaagactgcagtaaacattagccagccttctgaaccttct
gatccagtgaccatcgtcgcagaaaatgttcctcccagaatagacctgagtgtggctatg
aaatctttgcttactgtaaaagctggaactaatgtttgcctggatgctactgtttttggt
aaaccaatgccaacagtctcctggaagaaggaaggcacactgctacaaccagcagaaggc
ataaagatggccatgaagcgaaacctgtgcaccctggagctgttcagtgtgaacagaaag
gactcaggagactataccattactgctgaaaattcaagtggttccaaatcagccaccatt
aagcttaaagtgttagataaaccaggtcctccagcatctgttaaaatcaacaaaatgtat
tcagatcgtgcaatgctttcttgggaaccacctcttgaagacggaggctcagaaatcacc
aactatattgttgacaaacgtgaaacaagcagacccaactgggcacaagtctctgctact
gtgcccatcaccagctgcagcgtggagaaactcatagagggccatgagtatcagttccga
atttgtgctgaaaataaatatggagtgggcgacccgatcttcactgaaccagcagttgct
aaaaacccatatgacccacctggacgctgtgatcctcctgttattagcaacatcaccaaa
gatcatatgacagtaagctggaaaccgccagcagatgatggcggctcacccatcactggc
tatttggtggaaaagcgggaaacccaggcagtaaactggactaaggtcaacagaaagcct
gttatagaaagaacaataaaagcaacaggtctccaagaaggcaccgaatacgagttccga
gttacagcaataaataaggctggaccaggcaaacccagcgatgcatccaaagctgtttat
gcccaggaccctctctatcctcctggcccaccagcttttcctaaagtatatgatacaacg
cgtagctccgtgagtctatcttggggcaagccagcctatgacggtggtagccctatcatt
ggttaccttgttgaagtaaaacgagctgactctgataactgggtgaggtgcaatttacca
cagaagctacagaagacccgctttgaggttaccggcctgctggaaaacacagagtatcaa
ttccgcgtgtatgccgttaataagattggatacagtgaccccagtgatgtgccagacaaa
cattgtcccaaggacatcttaattccacctgagggagaacttgatgccgatttgaggaaa
acactcatattacgtgctggagttacaatgagactgtatgtaccagtaaaaggacgtcca
cctccaaagataacttggtctaaaccaaatgtcaatctaagagaaaggattggactggac
ataaagtcaactgactttgacactttcttgcgctgtgaaaatgtaaacaaatatgatgca
ggaaaatatatcttgactctggagaacagctgtggtaaaaaggagtataccatcgtagtg
aaagtgctcgatactcctgggccacccgtcaatgtgactgttaaggaaatatccaaagat
tctgcttatattacctgggatcctcccattattgatggtggaagccctatcataaattat
gtggtagaaaaacgtgatgcagagaggaagtcctggtctacagtgacaactgagtgctca
aaaacaagcttcagagtatcgaacttggaggagggaaaatcctacttcttcagggtgttt
gctgaaaacgagtatggcattggtgatcccggtgaaacacgtgatgccgtcaaagcttct
gaaacccctggaccagttgtggacctgaaagtgacgtctgtaactaagtcatcttgtagc
ataggctggaaaaagcctcgcagtgatggtggaagtcgaataattggatatgtggttgat
ttcttgaccgaagaaaataagtggcaacgagttatgaaatcagcaagtttacagtactcc
acaaaagatttgactgaagggaaggaatataccttcagagtgagtgctgagaatgaaaat
ggagaaggaaccccaagtgaaatcactgctgtagcaaaggatgatgttgtggctcctgac
cttgacttaaaggatctacctgatttgtgctacttggctaaagaaaacagcaacttccgt
cttaagatccccataaaaggcaagccagctccatcagtatcctggaagaaaggagaagat
cctctagcaactgacacaagagtcagtgttgagtcatctgcagtcaacacaactcttgta
gtatatgattgccaaaaatctgatgctggaaaatacacaatcacactgaaaaatgttgct
ggcaccaaggaaggaactctctctataaaagttgttggcaagcctggcatccccactggg
ccaatcaaatttgaggaagtcacagcagaagccataaccttaaagtggggtcctccaaag
gacgatggaggttctgaaatcaccaactatatcctagagaagagagattctgtaaacaac
aagtgggtgacctgtgcctcagctgtccagaaaaccacatttagagtaaccagacttcac
gagggtatggaatacaccttcagggtcagtgccgaaaataaatacggtgtaggagagggc
ctgaaatcggagccaattgttgctaaacatccattcgatgtgcctgatgctcccccacct
cccaatattgtggatgtcagacatgattcagtatctctaacttggactgaccccaggaaa
accggtggctctccaattacagggtatcatattgagttcaaggaaagaaacagcctcttg
tggaagagagctaacaagactcctattaggatgaaagacttcaaagtgacaggattaact
gaaggccttgaatatgaattccgagtcatggctatcaatttagcaggagtaggaaagcca
agcctgccatcagagccagttgtggcacttgatccaattgatcctcctggcaaacctgag
gttattaatgtaacaaggaattcagtgactctcatttggactgaacccaaatatgatggt
ggtcataaattgactggctatatagtggagaagcgggatctaccctctaaatcttggacg
aaagccaatcatgttaatgtcccagattgtgcctttactgtaactgaccttgttgagggt
ggaaaatatgaattcagaattagagcaaaaaatacagcaggtgccatcagtgctccatca
gagagtacaggaaccattatttgcaaggatgaatatgaggcgccaaccattgtccttgat
cccacaataaaagatggactaacaattaaagcaggagataccattgttttgagtgccatt
agcattcttggcaagccccttccaaagtcaagttggtccagggcaggaaaagacattaga
ccatcagatatcgttcagatatcttcgactccaacatcttccatgcttactgtcaagtat
gccactagaaaagatgctggtgaatacaccatcactgctaccaatccttttggcacaaag
gaggaacatgtgaaggtaatagtccttgatgtacctggtcctccaggtcccattgaaatc
agtaatgtttctgctgaaaaagcaacacttacatggacacctcctttggaagatggtggc
tcaccaattaagtcctatattcttgaaaagagagaaaccagccgacttttgtggacagtc
gttgctgaagatattcagtcttgcaggcatgtggcaaccaaacttatccaaggaaatgag
tacatcttccgggtctcagctgtaaaccaatatggcaaaggagaacctgtgcagtccgaa
cctgtcaaaatggtagacagatttggtccccctggccctcctggaaaaccagagatttca
aatgtcactaaaaacaccgccactgtcagttggaaaagaccaactgatgatggtggcagt
gagatcacgggatatcatgtagaaaggagagaaaagaaaagtttgcgatgggtgagagca
acaaagacaccagtttctgatctcagatgcaaagtaacaggactgcaagaaggaaacacc
tacgaattccgtgtcagtgcagaaaacaaagcaggagttggtccacctagtgatgcttcc
aatcctgttctaatgaaagatgtagcatatcccccaggaccaccttcgaatgcacgtgtc
actgatactaccaagaaatctgcttctttggcatggggcaagcctcattatgatggtgga
cttgaaatcactggctacgtcgtggagcatcaaaaagtaggagatgaggcctggataaaa
gatacaacaggaactgccctcagaatcactgagtttgttgtccctgatcttcagactaaa
gaaaaatacaattttagaatcagtgccatcaatgacgcaggtgttggggagccagcagtg
attccagatgttgaaattgtagaacgagaaatggctcctgatttcgaactagatgctgag
cttcgaagaacacttgttgttcgagcaggactcagtattagaatatttgtgccaattaaa
ggtcgtcctgctcctgaagtgacatggaccaaagatgacatcaaccttaaaaacagagct
aacattgaaaatacagaatcatttactcttctgattatcccagaatgtaacagatatgac
actggtaaatttgtgatgaccatcgaaaaccctgctgggaagaaaagtggcttcgttaac
gtcagagtcttggatacaccgggaccagtccttaacctgaagcctactgacatcacaaag
gacagtgtcaccctccactgggacctccctctgatagatgggggctcacgtataacaaac
tatattgtggagaaacgagaagcaacacggaaatcttactccacagtcactactaagtgc
cataaatgcacatataaagttaccggcttgtctgaaggatgtgaatacttcttcagagtg
atggcagaaaatgaatatggaatcggcgagccaacagaaacaacagaacctgtaaaagcc
tctgaagcaccatcaccaccagacagtcttaacattatggacataactaagagcacagtg
agcctggcatggcctaaaccaaaacatgatggtggcagtaggatcactggctacgtgatt
gaagcccagagaaaaggctctgaccagtggacccacatcacaaccgtgaagggattggaa
tgtgtcgtgaggaatctaactgaaggggaagaatataccttccaagtgatggcagtgaac
agcgcagggagaagtgcccctagagaaagcagacctgtcattgtcaaggagcagacaatg
cttccggaactggacctccgtggcatttatcagaaattagtcattgccaaagctggtgac
aacatcaaagttgaaattccagtgcttggtcgaccaaagcccacagttacgtggaaaaaa
ggagaccaaatacttaaacagacacagagagttaattttgaaaacacagcaacctcaacc
atcttaaatatcaacgagtgtgtgagaagtgacagcgggccctatcctttaacagcaaag
aacattgtaggagaggttggtgatgtcatcaccattcaagtccatgatatcccagggcca
cctactggaccaatcaaattcgatgaagtttcatctgattttgtaaccttctcttgggac
ccacctgagaatgacggaggtgtaccaataagcaactatgtagtagaaatgcgacagact
gacagtactacatgggtcgagttagcaaccaccgttatacgcactacctataaagccact
cgtcttactaccggaatggagtatcaattccgggttaaagctcaaaacagatacggagtt
ggaccaggcatcacatcagcatctatagttgctaattatccgtttaaggttcctgggcct
cctggtacccctcaggtaactgcagttaccaaagattcaataacaattagctggcatgag
cctctttctgatggtggaagccccattttaggatatcacattgaaagaaaagaacgaaat
ggtattctctgggagactgtgagcaaagcattagtaccaggcaacattttcaaatcaagt
ggacttacagatggtattgcttatgaattccgagtgattgcagaaaacatggcaggcaaa
agcaagccaagcaagccatctgaacctgcatttgctttggatcccattgacccacctggg
aaaccagttcctctaaatattactagacacacagtgacacttaaatgggctaagcctgaa
tatactggaggctttaaaattaccagttatatagttgaaaagagggaccttcctaacgga
cggtggctaaaggccaacttcagcaacattttggagaacgaatttacagtcagtggccta
acagaagatgctgcatatgaattccgtgtgattgccaaaaatgctgctggggctattagt
ccaccatctgagccatcagatgctatcacatgcagggatgacattgaagcaccaaggata
atggtggatgttaaatttaaggacacagttatattaaaagcaggtgaagcatttaagctg
gaagctgatgtttcaggtcgcccacctccaacaatgacatggaccaaagatggaaaagag
cttgaaggcacagcaaaattagaaattaaaattgcagatttctctactaatctggtaaac
aaggattcatcaagaagggatggtggtgcctatacccttactgcgactaatcctggtggt
tttgctaaacatattttcaatgtcaaagttcttgatagaccaggcccacctgaaggacct
ttagctgtatctgaagtaacgtcagaaaaatgtgtattgtcatggttgcctccactagat
gatggaggtgccaaaattgagcattatgtagttcagaaacgtgaaactagcagattggca
tggacaaatgtagcctcagaagttcaagtaacaaaactaaaggtcactaaacttttgaaa
ggcaatgaatacatattccgtgtcatggctgtaaataaatatggagttggagagccactg
gaatcagagcctgtgcttgcagtagatccttttggacgccctgatccacccaaaaaccct
gaagttacagctattactaaagattcaatggttgtctgctggggacatcctgactctgat
ggcggaagtgaaatcatcaattatatcgtggaacggcgtgataaggccgggcaacgctgg
gtgaaatgcaacaaaagaactcttaccgatttaagatataaagtgtctggactgacagag
ggacatgaatatgagttcaggattatggctgaaaacgctgctggaattagtgcaccaagt
cctaccagtccgttttataaagcttgtgatactgtgtataaacctggcccaccaggtaac
ccacgtgttctggatacaagcagatcatccatttcaattgcttggaataaacctatctat
gatggtggctccgaaatcactggatacatggtcgagattgccctgccagaggaagatgaa
tggaagattgtcactccaccagctgggctcaaggcaacttcttacaccatcaccaacctc
acagagaatcaggaatataaaatccgcatctatgccatgaattctgaaggtattggggaa
cctgcacttgttcctggaactccaaaggctgaagagaggatgctgcctccagagattgaa
ctggatgctgacctgcgcaaagttgttactataagagcttgctgtaccctgagacttttt
gttccaatcaaaggaaggcctgcacctgaggtgaagtggacccgggaacatggagaatct
ttagataaagctagcattgaatccaccagctcttatacgctgcttattgttggaaatgta
aacagattcgacagtggcaaatatatcctaactgtagaaaacagctcaggcagcaagtcg
gcatttgtcaatgtcagggtactagatacaccaggccctccacaggatctcaaggtaaag
gaggtcactaaaacatctgtcacattgacatgggagcctcctctccttgacggaggttca
aaaataaagaactatattgttgaaaagcgggaatcaacaagaaaggcatattcaactgtt
gcaacaaattgccacaagacttcctggaaggtagaccagcttcaagaaggctgcagttac
tatttcagggttctcgctgaaaatgaatatggcatcgggctgcctgctgaaaccgcagaa
tctgtgaaagcatcagaacgacctcttcctccaggaaaaataactttggtggatgtcaca
agaaacagcgtgtcactctcatgggagaaaccagagcatgatggaggcagtcgaattcta
ggttacattgtagagatgcagagcaaaggcagtgacaaatgggtcacatgtgccacagtc
aaagtcaccgaagccactataactggattaattcagggtgaagaatactctttccgtgtt
tcagctcagaatgaaaagggcatcagtgatcctagacaactgagtgtgccagtaattgcc
aaggatcttgtcattccaccagccttcaaactccttttcaatactttcactgtactggca
ggtgaagacctaaaagttgatgttccattcgttggacgccctacgccagctgtaacatgg
cataaagatgatgtgccactgaaacagacaactagagtaaacgcagagagcacagaaaat
aattcactactgacaataaaggaagcctgccgagaagatgttggacattacacagttaaa
ctgactaactcagctggtgaagccactgaaacccttaacattattgttcttgacaaacca
gggcctccaactggaccagttaaaatggatgaagtgacagctgatagtattactctttcc
tggggcccacctaagtatgatgggggaagttctatcaataattacattgtagaaaaacga
gacacttccacaactgtctggcaaattgtgtcagctactgttgcaaggacaacgataaag
gcttccagattaaagactggatgtgaatatcagtttaggattgcagctgaaaacagatat
ggaaagagtacctacctcacttcagagcctattgtagcccagtatccattcaaagttcct
ggtcctcctgggacaccattcgtaaccctctcctccaaggacagcatggaagtacagtgg
aatgagccagtcagtgatggaggcagcaaagtcattggctatcatctagaacgcaaggaa
agaaatagcatcctctgggttaagttgaataaaacacctattcctcacaccagatttaaa
acaactggcctcgatgaaggcattgaatatgaatttagagtctccgcagaaaatatcgtg
ggcatcggccagccaagtaaagtgtcagaatgctatgtagcgcgtgacccatgtgatcca
ccagggcggccagaggcaatcatggtcacacggaattctgtgactcttcagtggaagaaa
cccacttatgatggtggaagcaagatcactggttatgttgttgaaaagaaagaattgcct
gacggccgttggatgaaagccagttttacaaatgttattgacactcaatttgaagtaact
ggcctagttgaagatcatagatatgagttccgggttatagctcgaaatgctgcaggagtg
tttagtgagccttcagaaagcacaggagcaataacagcaagagatgaggtagatccacca
cgaataagtatggatccaaaatataaagacacaattgtggttcatgctggtgagttattc
aggattgatgcagatatttatggcaaaccaataccaaccattcaatggataaaaggtgat
caggagctttcaaatacagctcgattagaaataaagagcactgactttgccactagtctc
agtgtaaaggatgcagtacgcatcgacagtggaaattacatattgaaggccaaaaatgtt
gcaggagagagatcagttaccgtaaatgttaaagttcttgatagaccagggccacctgaa
ggacctgttgttatatcaggagttactgcagaaaaatgcactctagcttggaaaccccca
ctacaggacggtgggagtgacatcataaattatattgtggaaagaagagaaaccagccgc
ttagtttggactgtggttgatgccaatgtgcaaactctcagctgcaaggttactaagctt
ctggaaggcaatgaatatactttccgtataatggctgtaaacaaatatggtgttggcgaa
cctctcgaatctgagccagtaatggccaagaatccatttgtagttccagatgcaccaaag
gctccagaaatcaccacagtgaccaaggactcaatgattgttgtatgggaaaggccagca
tctgacggtggcagtgacatacttggatatgttcttgaaaaacgggataaggagggcgtt
cgatggacaagatgccacaaacgtctgattggggaattgcgcttgagagtaactggactc
ttagaaaatcacaattatgaattcagagtctcagccgagaacgctgctggacttagtgaa
ccaagcctaccttccgcttaccaaaaggcttgtgatcctatttataaaccaggacctcca
aacaatcccaaagtcatagatattaccaggtcttctgtcttcctttcttggagcaaacca
atatatgacggtggctgtgaaatccaaggatacattgttgaaaaatgtgatgtgagtgtt
ggcgaatggacaatgtgcactccaccaactggaatcaataaaacaaatatagaagtagag
aagctgttggaaaagcatgaatacaacttccgtatctgtgctgttaataaagctggagtt
ggagaacatgctgatgtccctggacctgttatagttgaagaaaaactggaagccccagac
attgatcttgacctagaactaaggaaaattataaatataagggcaggtggctccttaagg
ttatttgttcctattaaaggtcgccctacaccagaagttaaatgggggaagatggatggt
gaaatccgagatgcagctataattgatgtcactagcagtttcacctctcttgttcttgac
aatgtcaaccgatatgatagtggaaagtacactctcacattagaaaacagcagtggaaca
aagtctgcctttgttaccgtgagggtcctggacacaccaagtccacctgttaacctgaaa
gtcacagaaatcactaaagactcggtttcaattacgtgggaaccacctttgttggatggg
ggatccaaaatcaaaaattacattgttgagaaacgtgaagccacaagaaaatcgtatgct
gcagttgtaacaaattgccataagaattcttggaaaatcgaccaactccaagaaggttgc
agttattactttagagtcacagctgagaacgagtttggtattggccttcccgcccacact
gctgatccagttaaggttgcagaagtcccacaacctccaggaaaaataactgtggatgat
gtcaccagaaatagtgtctccttgagttggacaaagcctgaacatgatggtggaagtaaa
atcattcagtatattgtggaaatgcaagctaagcacagtgagaaatggtcagagtgtgct
cgtgtcaagtcccttgaagcagtaattaccaacctaactcagggagaagaatatcttttt
agagttgttgctgtaaatgaaaaggggagaagtgatcctaggtcccttgcagttccaata
gttgccaaagatctggtcattgagccagatgtaagacctgcattccacagttatagtgta
caggttggccaggatttgaaaatagaagtgccaatttctggacgtcctaagccaaccgtt
acctggactaaggacgatcttcctctgaagcagactacaagaatcaatgttactgattca
cttgaccttactgtactcagtattaaagaaactcataaggatgatggtggacattatgga
atcacggttgctaatgttgttggtcagaaaacagcatctattgaaattataactctagat
aaacctgatcctccaaaaggacctgttaaattcgatgaagtcagctctgaaagtattaca
ttatcttggaaccctccgctatatacagggggctgccagatcaccaactatattgttcag
aaaagagatacaaccaccacagtatgggatactgtttctgctactgttgccagaactaca
ctcaaagtgaccaaactgaaaactggtacagaataccaattcagaatattcgctgaaaac
agatatggacaaagctttgccttggagtctgatccaattgtagctcaatatccctacaaa
gaaccagggcctccaggcacaccatttgtcacaaccacttccaaagactccatggttgta
cagtggcatgaaccaatcaataatggtggaagcccagtcataggttaccaccttgagaaa
aaggaaagaaatagtattttgtggacaaaagtcaacaaatctattattcatgacacccag
tttaaagcagtcaatcttgaagaaggcattgaatatgaattcagagtttatgctgaaaat
attgttggtgtaggcaaagtaagcaagaattccgaatgctacgtagccagagatccctgt
gacccaccaggaaccccagaagcaataatggttaaaagaaatgaaatcactttacaatgg
accaaacctgcatatgatggtggaagtatgatcacgggttacattgtggagaaacgtgat
ttgcctgagggtcgttggatgaaagctagcttcacaaatgtcattgaaactcaatttact
gtgtcaggtcttactgaagatcaaagatatgaattcagagtcattgcaaagaatgcagct
ggtacaataagtaaaccctccgacagtactggaccaataactgccaaggatgaggttgaa
cttccaagaatttcaatggatccaaaattcagagacacaattgtggtaaatgctggagaa
acattcaggcttgaggctgatgttcatggaaagcccctacctaccattgagtggttaaga
ggagataaggaaattgaagaatctgctaggtgtgaaataaagaacacagatttcaaagct
ttacttatcgtaaaggatgccattagaattgatggtggacagtatattttaagagcttcc
aatgttgcaggttctaagtcattcccagtaaatgtcaaagtattagatagaccaggacct
ccagaagggccagtccaggttaccggagtcacttctgaaaaatgcaatttaacatggtct
ccaccacttcaagatggtggcagtgacatttctcactatgttgttgaaaagagagaaacg
agtcgacttgcctggactgttgttgcttcagaagttgtgaccaactccctgaaaattacc
aaactcttagaagggaatgaatatattttccgtataatggctgtcaacaaatatggggtt
ggagagcctttggaatctgcaccagtactaatgaaaaatccatttgtgcttcctggacca
ccaaaaagcttggaagtcacaaacattgccaaggactccatgactgtctgttggaaccgt
ccagatagtgatggtggaagtgagattattggttacattgtagagaaaagagacagaagt
ggcattaggtggataaaatgtaataaacgccgcattacagatttgcgcctaagagtaaca
ggattaacagaagatcatgagtacgaattcagagtctctgcagaaaatgctgctggagtt
ggagaaccgagtccagctacagtttattataaggcttgcgatcctgtgttcaaacctggc
ccacccatcaatgcacatgttgtagacaccactaaaaattcaattacacttacctggggt
aaacccatctatgatggtggcagtgagatcctgggatatgtagtagaaatatgtaaagca
gatgaagaagaatggcaaatagttactccacagactggcctgaaagccactcgatttgaa
atttcaaaactcactgaacaccaagagtacaaaatacgagtctgtgccctcaataaagtt
ggtttaggtgaggctacgtcagttcctggtactgtgaaaccagaagataaactcgaagca
cctgaactggaccttgactctgaattaaggaaaggaattgttgtaagagctggtggatct
gccagaattcacattccattcaaaggtcgtccaacacctgacatcacttggtctcgagag
gaaggtgaattcacagataaggtccaaattgaaaagggagtaaactatacccaactatca
atagataactgtgatagaaatgatgctggaaaatacattctcaagctggaaaatagcagt
ggatctaaatctgcttttgtaactgtgaaagttcttgacactccaggaccaccacagaat
ttggcagtcaaagaagtgaaaaaagattctgtcattcttgtatgggaaccacccatgatt
gatgggggcgcaaaggtcaagaactatgttattgacaaacgtgagtcaaccagaaaagca
tatgctaatgtgagtaataaatgcagcaaaacaagccttaaagttgagaatcttacagaa
ggggccatttattactttagagttatggctgaaaatgaatttggagttggcgttccagtg
gaaactgttgatgctgtgaaagctgctgaacctccttccccaccaggaaaggttacactc
actgatgtgtcccagaccagtgcatcgcttatgtgggagaaacctgaacatgatggtggg
agcagaatcctggggtatgttgttgaaatgcagcccaaaggaactgaaaaatggagtgtt
gtggctgaatccaaagtctgtaatgcagttattactggtttgagttctggacaagaatat
cacttccgtgtcaaggcttacaacgagaaaggaagaagcgatccaagagtgcttggtgtt
cctgtcatagccaaggacttgaccataccgcctagtttcaagttaccatttaacacatat
agtgtccaagctggagaagatcttaaaattgaaattccagttattggccgaccaagacct
gaaatttcatgggtcaaagatggcgagcctcttaaacagacaacaagagtaaatgttgag
gaaacagctaattcaactattttgcacattaaagaaactaacaaagatgattttggaaag
tataccataacagcaacaaatattgccggtacagcaacagaaaatctcagcattattgtt
ttggaaaagcctggacctccagttggaccagttcggtttgatgaagttagtgcagacttt
gtggtcatatcttgggaacctccagcctatactggtggctgccaaataagcaactacatt
gtagagaagcgagatacaaccaccaccacttggcaaacggtatcagcaacagttgcaaga
acaacaattaaaatagccaaactgaaaacaggcactgagtaccagtttagaatttttgca
gaaaacaggtatggaaaaagtacccacctggattctaaaccagttattgtacaatatcca
tttaaagaacctggaccacctggaactccttttgtgacatcagtctcaaaagatcaaatg
cttgtgcaatggcatgagccagttaatgatggaggtagtaaagttattggctaccatctt
gaacagaaagaaaagaacagcattttatggatcaaattaaataagactcccattccagac
accaaattcaaaacaactggccttgatgaaggccttgagtatgagttcagagtttctgct
gaaaatattgttggcatcggcaagcctagcaaagtgtcagaatgctttgttgcccgtgat
ccatgtgacccacctggtcgccctgaagccattgttattacaagaaacaatgtcacactg
aaatggaagaaacctgcctatgatggtggcagcaaaataacaggttatattgtagaaaag
aaagacctacctgatggccgttggatgaaagccagctttaccaatgtattagaaactgaa
tttacagtgagtggacttgtagaagaccaaagatacgaatttagagtaattgcaagaaat
gcagctggcaactttagtgaaccatctgaaagcactggtgccattactgcaagagatgaa
attgatgcaccaaatgcctcactggatccaaaatataaagatgttatcgttgttcatgca
ggagagacttttgtcctggaagctgatatccgcggcaaacccatacctgatattgtttgg
ttaaaagacggaaaagagcttgaagaaacagctgctaggatggaaattaagtctactatc
cagaaaacaactcttgttgtcaaagactgtatacgtactgatggaggacaatatattctg
aaactcagcaatgttggtggtacaaagtctataccaatcactgtaaaggtacttgacagg
ccagggcctcctgaagggcctctgaaagtttctggggttactgctgaaaaatgttacttg
gcatggaacccacctttgcaagatggtggtgctaatatttcacattacatcattgaaaag
agagagacaagcagactctcatggacccaggtttcaactgaggtacaggcccttaactac
aaagtcactaaacttcttcctggaaatgagtacattttccgtgtcatggctgtgaataaa
tatggagttggagagcctttggaatctgaacctgttatagctcgtaatccttataaacca
ccaggtcctccttcaccacctgaagtctcagcaatcaccaaagattctatggtagtaacg
tgggcacgcccagtggatgatggaggtgctgaaattgagggatacattcttgaaaaacga
gataaggaaggcgttagatggaccaagtgcaacaagaaaacactaacagatctccgattc
agggtaactgggcttaccgaaggtcattcctatgaattcagagttgctgccgaaaatgca
gctggtgtgggtgaacccagcgagccatctgttttctaccgtgcatgtgatgctttgtat
ccaccaggtccaccaagtaatccaaaagtgacagacacttccagatcttctgtctccctg
gcatggaataagccaatttatgatggtggtgcccctgttaagggctacattgttgaagtc
aaagaagccactgctgatgaatggacgacttgcactccaccaacaggattacaaggaaag
cagttcacagtgaccaaccttaaagaaaatactgaatataacttccgcatttgtgccatc
aattctgaaggtgtaggtgaacctgcaactatacctggttcagttgttgctaaagacagg
ttagagccaccagaaatagaacttgatgctgatctcagaaagatggtcgttctgcgtgca
agtgctactttacgcttatttgtcactatcaaaggtcgaccagaacctgaagttaaatgg
gaaaaagccgaaggcattctcactgagagggcccagattgaggtgaccagctcatacaca
atgttggtgatcgataatgttaccagatttgacagcggtcgatataatctgacactagaa
aataacagtggctctaaaacagcttttgttaacgtcagagtccttgactcaccaagtgcc
cctgtgaatttgagtgtaaaagatgtgaagaaagactcggtgacattgtcttgggaacca
ccacttatcgatggtggagccaaggttacaaactacattgttgaaaaacgagaaactaca
agaaaagcctatgctactgttacaaacaattgcactaagactacttttaaaattgaaaat
ctacaagaaggatgttcttactacttccgagtcttggcttgcaatgaatacgggattggt
ttgccagctgaaacaagtgaacccgttaaagcttctgaaccacccctcccacctggaaga
gtaactcttgttgatgtgaccagtaacacagctacaattaagtgggagaaaccagaaagt
gacggtggcagcaaaattactggttatgtggttgaaatgcagactaaagggagtgaaaaa
tggagcacttgcacacaagttaagactctagaagcaactatatctggcctaacttcagga
gaagagtatatcttcagggtagctgctgttaatgaaaaaggaagaagtgatccaagacaa
cttggagtgccagtaattgcaagggatattgaaataaagccttcagttgagcttcctttc
catactttcaatgtaaaggctagagaccaacttaagattgatgttccatataaaggaaga
cctcaagctactgtaagctggaaaaaagatggtcagactctaagagaaacaactagagtc
aatgtttcttcttcaaagactgtaacatcactatctattaaggaagcctcaagagaagat
gttggaacttacgaattatctgtttcaaacagtgctggatccataacagttcctattact
gtaattgtccttgacagaccaggacctccaggacctatacatattgacgaggtcagttgt
gacaatataaccatttcttggaatcctccagaatatgatggtggctgccaaattagcaat
tacatcgttgaaaagagagaaaccacttctacaacttggcatgtagtttcacaagcagtt
gcgagaacatctattaaaatagttcgcctgacaacaggaagtgagtatcagttccgtgtc
tgtgcagaaaaccgctatggaaagagcacctacagtgactctccagctgttgttgcagag
tatccattcagccccccaggtcctcctggtactcctaaagttgtgcatgccacgaaatct
accatgattgtaacctggcaagtgccagttaatgatggaggaagtcaagtaattggctat
caccttgagtataaagaaagaagcagcattctttggtcaaaagcaaataaaatcctcatt
gctgatactcaaatgaaagtctctggccttgacgaaggactgatgtatgagtatcgtgta
tatgctgagaatattgctggaattggtaaatgcagcaagtcttgtgaaccagtccctgca
agagatccttgtgaccctcctggacaacctgaagtcacaaatatcacaagaaaatcagtg
tcacttaaatggtctaagccacattatgacggtggagctaagatcacaggatacattatt
gaacgtagagaactaccagatggccggtggctgaagtgcaattttactaacgtacaagaa
acatactttgaagtaactgaacttactgaagatcaacgttatgaattccgggtttttgca
aagaatgctgccgactctgttagtgaaccatctgaatccactggaccgattactgttaaa
gatgatgttgaggctccaagaattatgatggatgtcaagttccgagatgttattgttgtc
aaagctggagaggttcttaaaataaatgcagacattgcagggagacctctgccagtaatt
tcctgggccaaggatggtgtagaaattgaagaaagagcaagaacagaaattgtctcaaca
gactataatactttgttaacagtgaaagactgtgttagacgagacactgggcaatacata
ctaacactgaagaatgttgcaggaactcgttctgtggcagttaattgcaaggtacttgat
aagcctggcccaccagccggaccacttgaaatatatggtctcactgctgagaaatgctct
ctttcctggggaccgccccaagaaaatggtggtgcagatattgactattacattgtagaa
aaacgtgaaacaagccgccttgcatggacaatatgtgaaggagagttaaggacaacatcc
tgtaaagtaaccaagttactcaaaggcaatgaatacatctttagagtaacaggtgttaat
aaatacggtgttggtgagcccctcgagagtgtggctgtaaaggcactagatccatttaca
gttccaagtccacccacatctttggaaattacctctgtgaccaaagattccatgacactt
tgctggtcaagacctgagagtgatggaggtagtgaaatttctggatatataatagaaagg
cgagagaaaaacagcgtacgatgggtgcgtgtaaacaaaaaaccagtttatgatctgaga
gtgaaatcaacaggacttcgggaaggatgtgaatatgagtatcaggtttatgcagaaaat
gctgctggcctaagccttccaagcgaaacctctcccttaattcgggcagaagatccagtg
ttcttaccatctcctccagctaaacccaaaattgtggactcaggcaagacaaatataact
attagctgggttaagcccttatttgatggtggggccccagtaaccggatacactgtggaa
tataaaacgtctgatgaaactgactggaaaactgccattcagaacttaagaggcacagaa
tatacaataagtggactaacaacaggagctgaatacgttttcagagtaagatccatcaat
aaggtcggtgctagtgatcccagtgatagctccgatccccagatagcaaaggaaagagaa
gaagaacctgtatttgatcttgacagtgaaatgaagaagaccttgattgtcaaggccggt
gcctcatttactatgactgtgcctttccgaggaagaccagtacccaatgtctcgtggagt
aagccagacactgacctccgcactagagcctatattgattccacagactctcgtacatca
cttactattgaaaatgccaacagaaatgattctggaaaatacacattaacaattcagaat
attttgagtgctgcttcgctcaccttagttgtcaaggttttagattctcctggacctccg
gctaatatttctgtacacgatgtcaccaaagagtctgcagtgttatcctgggatgttcct
gaaaatgatggtggagcaccagtgaagaattaccacatagaaaaacgtgaggccagtaag
aaagcatgggtctctgtgaccaacaactgtaaccgcctctcctacaaagttaccaactta
caagaaggggcgatttactacttcagagtctctggagaaaacgagtttggtgttggtgta
ccagctgaaacaaaggatggagtaaaaataacagaaaaaccaagcccacctgaaaaactt
ggagtaacaagtgtatccaaggatagtgtttccctgacctggctgaagccagaacacgat
ggtggaagcagaattgtacattatgtcgttgaagcactagaaaaaggacataaaaattgg
tttaaatgtgcagtggtcaagtcaacccatcacgttgtttctggtctgagggagaattct
gaatactttttccgggtgtttgctgaaaatcaagctggtctgagtgacccaagagagctt
ctgcttcctgttcttattaaggagcaactagaaccacctgaaatcgatatgaagaatttc
ccaagtcaaaccgtatatgtcagagctggttcaaaccttaaagttgacattccaatttct
ggaaaaccactgcccaaagtgaccttatcaagagatggtgtccccctgaaagcaaccatg
agatttaacactgaaattactgctgagaacctcaccatcaatctcaaagaaagtgttgct
gctgatgctggaagatatgagatcactgctgccaactctagtggaacaacaaaaactttc
attaacatcattgtcctggacaggcctggtcccccaactggccctgttgttattagtgat
ataactgaagaaagtgtgactctcaaatgggagccacctaagtatgatggtggaagtcag
gttaccaattatattgtactcaagagagagacaagtactgcagtatggactgaagtgtcc
gcaacagttgcaagaaccacgattaaagtcatgaaactgaccagaggagaagaataccaa
ttccgcatcaaggcagaaaaccgctttggcatcagcgatcacatagattcagcttgtgtg
gttgtcaaactcccatacacaacacctggaccaccatctacaccatgggtcactaatgtc
actcaggaaagcatcactgtgagctggcatgaaccagtatccaacggaggcagtgcagtt
ataggttatcacctggaaatgaaagacagaaacagtattttatggcaaaaagtcaacaaa
atgatcatccgcacaactcacttcaaagtcacaacaatcagtgctggacttatttatgaa
ttcagagtatatgcagaaaatgctgctggtgttggaaagcccagccatgcttccgaacca
gtcctagccattgatgcctgtgaacccccaagaaacatccgtatcactgatatttcaaag
aactctgtcagcctttcatggcaacaaccagcttttgatggaggaagcaagattacaggc
tacattgttgagagacgagaccttccagatggcagatggaccaaggccagcttcaccaat
gttattgagactcaattcattgtctctggcttgactcagaattctcagtacgaattccgt
gtctttgctaggaatgccattggttccatcagcaatccatccgaggttgtaggccccgtt
acatgcattgattcttatggtggacctgtaattgatttgcctctagaatatacagaagtt
gtcaaatacagagcaggtacatctgtgaagctcagagctggcatttctggcaaacctgag
cctacaattgagtggtttaaagatgataaagagttacaaaccaatgcacttctgtgtgtc
gaaaataccactgaccttgcgtctatactcatcaaagacgcaaatcgccttaatagtgga
agatatgaattaaaactaaggaatgccatgggctcagcttcagccaccatcagagtgcag
atccttgacaaaccaggacctccaggtggaccaattgaatttaagaccgtcactgctgaa
aagatcactctgctctggcggcctccagtagatgatggcggtgcaaaaatcacccactac
gttgtggaaaagcgtgaaacaagccgcgttgtgtggtctatggtgtctgaacatttggaa
gagtgcatcattaccaccaccaaaattatcaaaggaaacgaatacgtcttccgggttcgc
gctgtgaacaaatatggaattggtgatccactggaatctgatccagtggtagcaaagaat
gcatttgttacacctgggcctccaagcataccagaggtgacaaagattaccaagaattca
atgactgttgtctggaacaggccagttgcagatggtggtagtgaaataagtggctatttc
cttgaaaaacgagacaagaagagtctaggatggtttaaagtactcaaggagactatccgt
gacaccagacagaaagtggcaggactcacggaaaacagtgactatcaatacagagtttgt
gctgtaaatgctgctggacagggtccattttcggaaccatctgacttctacaaagcggct
gatcctattgatcctccaggcccaccagctaagataagaatcgcagattcaactaaatca
tccatcactcttggctggagtaaacctgtctatgatgggggcagtgctgtgactggatat
gttgttgcaatgagacaaggagaagaagaggaatggactgttgtctctaccaaaggagaa
gtcagaactacagaatatgtggtatctaacctgaaacctggagtcaattactatttccag
gtatccgctgtaaactgtgctggacaaggagaacctatagaaatgactgagcctgtacaa
gctaaagatatacttgaggaaccagagatcgacctagatgtggctctcagaacctctatt
atagctaaagccggtgaagatgtacatgtgttcataccgtttaaaggcagacctccacct
actgtcacatggagaaaagatgagaagaatcttggcagtgatgccagatatagcattcaa
aacactgattcatcttcgttactcattattcctcaagtcactcgcaatgatacgggaaaa
tatattctcacaatagaaaatggagttggtcagccaaagtcttcaactgtgagtgtcaaa
gtgcttgatacgccagccgcctgccagaaactacagattaaacatgtttctcaaggcaca
gtcacattgttctgggatcctcctctcattgatggaggatctcccataattaattacatc
attgaaaagagagatgccaccaagagaacatggtcctcagtgtcacacaaatgttccagc
acaacctttaaggtaaaagatttgtcagaaaaaactccattcttcttcagagttctcgca
gaaaatgaaattggaatcggggaaccttgtgaaactacagagccagtgaaggctgccgaa
gtaccagctccaatacgtgatctctcagtgaaagattcaacaaagacatctgttaccctg
agctggaccaagcctgactttgatggtggtagtgtcatcacagaatatgttgtggaaagg
aaaggtaaaggtgaacaaacatggtcacatgctggcataagtaaaacatgtgaaattgag
gttggccaacttaaggaactgtcagaactggaattcagagtgtctgccaaaaatgagaaa
ggactgagtgatgctgtcactattgggccagttacagtgaaagaacttgtaattacacct
gaagttgacctgtcagaaatccctggggcgcaagtcgctgtgagaattgggcataatgtg
cacctcgaattaccttacaaaggaaaacccaaaccgtctatcagttggctgaaagatggt
ttgccattgaaagaaagtgaatatgttcgtttcagtaaaactgaaaacaaaattactttg
agtattaagaatgtcaagaaggaaaatggagggaaatacaccgttattcttgataatgca
gtttgtagaacctcagttcccattacaatcatcacacttggcccaccatcaaagcccaaa
gggcccgttcgatttgatgaaatcaaggctgacagtgtcatcatgtcatgggatgtgcct
gacgatgatggaggaggagaaattacttgttacagcattgagaagcgggaagcttcacaa
aaaaattggaagatggtgtgctcgagtgttgccaggacaactttcaaagttcctaatcta
gtcaaagatgctgaataccagtttagagttagggcagaaaacagatacggagtcagccag
ccacttgtctcgaccatcattgtggcaaaacaccagttcaggattcctggccctccagga
aagccagttatatacaatgtgacttctgatggaatgtcactaacctgggatgctccagtt
tatgacggtggtgcagaagttactgggttccatgttgaaaagaaagaaagaaatagcatc
ctctggcaaagaattaatacatcaccaatatctggaagagaatacagagctactggacta
atggaaggcctggattaccagttccgtgtatatgctgaaaattctgccggcctaagcgca
cctagtgacccaagcaaatttaccttagctgtttccccagtagacccacctggcactcct
gactacattgatgtcacccgggaaaccatcacactgaaatggaacccaccattgcgtgat
ggaggcagtaagatcgtggcctacagcattgagaaacgacaagggagcgatcgctgggtt
agatgcaactttactgatgtcagtgaatgtcagtacacagtgacaggacttagtcctggg
gatcgatttgagttcagaataattgcaagaaatgctgttggaactataagcccgccctca
cagtcttctggcattattatgacaagagatgaaaatgttccaccaatagtagagtttggc
cctgagtactttgatggtcttactattaagtctggagagagccttagaattaaagctttg
gtgcaaggacgaccagtacctcgagtaacttggttcagagatggagtagaaattgagaag
aagatgaatatggaaataactgatgtccttggatccaccagcctctttgttagagatgct
acccgggaccatcgtggtgtatatacagtggaagccaaaaatgtatctggcaccgcaaaa
gcagaaattaaagtcaaagtacaagatacacctggaaaagtagttgggccaataagattc
accaacattactggcgagaagatgaccctatggtgggatgctccactcaatgatggctgt
gctcccataactcactacatcattgaaaaacgggaaaccagcagacttgcttgggcacta
attgaggataattgtgaaaccctcagttatactgctgttaaactaataactggcaatgaa
taccaattccgtatttctgcagttaacaagtttggtgttggcaggccacttgattctgac
cctgtggttgctcaaatacaatacactattcctgatgcccctggcactccagaacctagc
aatgtcacaggcaatagcattactctgacgtgggcaaggccagaatcagatggtggcaat
gaaattcaacaatatatcctcgaaaggagagaaaagaaaagcacacgatgggtgaaagtg
atcagcaaacgaccaatctctgagacaagattcaaagtcactggtctgacagagggcaat
gagtatgaattccacgtcatggctgaaaatgatgcaggagtaggacctccaagtgggatc
tcaagactaatcaaatgtagagagccagtcaacccaccaagtgctcccactgtggtcaaa
gtgacagatacatcaaagacaactgtgagcttagaatggtctaagccagtgtttgatgga
ggcatggaaataattgggtatattattgaaatgtgcaaagctgacttaggagactggcac
aaggtgaatgcagaggcatgtgtgaaaacaagatacacagtcactgatctacaagccggt
gaagaatacaaattccgggtgagtgctatcaatggtgctggaaaaggagacagctgtgaa
gtgaccggcacaattaaagcagttgaccgattaacagctcctgagttagatatcgatgca
aacttcaagcagactcacgttgttagagctggggccagtattcgcctcttcattgcctac
cagggtagaccgactcctacagctgtgtggaccaaacctgactctaacctaagcattcgg
gccgatatccatacaacagagtccttcagcaccctcactgtggaaaactgcaacagaaat
gacgcagggaaatataccctcaccgtggaaaacaacagtggtagtaagtcagtcacattc
accgtaaaggtgctagactctccaggcccacctggccccattactttcaaggacgtgacc
cggggatctgttacattgatgtgggatgcccctctccttgatggtggcgcccgcatccat
cactacgtggtagagaaacgagaagcaagtcgtcgtagctggcaggttgtcagtgaaaaa
tgcattcgtcagatcctcaaggtcaacgacctggtagaaggtgttccgtactatttccgt
gtttctgcagaaaacgagtatggtgttggtgaaccctatgaaatgccagaaccaatggta
gccacagaacagcctgctccacctaagagacttgatgttgttgacacaagcaaatcctcc
gcagtcttagcttggcttaaacctgaccacgatggaggcagccggattactggctacctg
ctcgaaatgagacaaaagggatctgacttctgggttgaagcaggtcacaccaaacagctg
actttcacagtggagcgccttgttgagaacactgaatatgaattccgtgtgaaggccaag
aatgatgctggctacagcgaacccagggaagccttctcttctgtcatcatcaaggagcct
caaattgagcccactgctgatctcactggaattaccaatcagctcataacttgcaaagca
ggaagcacatttaccattgacgtgccaatcagtggtcgtcctgcccccaaagtaacatgg
aagctcgaggaaatgagactaaaggagacagatcgagtgagcatcacaacaacaaaagac
agaaccactctgtctgttaaggacagcatgagaggtgactctggaagatacttcttgact
ctggaaaatacagctggagttaaaacatttaccatcacagttgtggtcattggaaggcca
ggtccagtaactggccccattgaggtctcatctgtctcagccgaatcatgtgtcctgtca
tgggctgaacctaaagatgatggaggcaccgatattactaattatatagttgaaaagcgt
gagtcgggtacaacagcttggcagcttgtcaattccagtgtcaagcgcactcagattaaa
gtcactcatctcacaaaatacatggaatattctttccgtgtcagttcagagaacagattt
ggtgtcagcaagcctctagaatcagcaccaataattgctgaacatccatttgtcccacca
agcgctcctaccagacccgaagtctactatgtgtctgccaatgccatgtctattcgttgg
gaagaaccctaccatgatggtggcagtaaagtcattggctactgggttgagaagaaagaa
cgtaataccattctttgggtgaaagaaaacaaagtgccatgcttagagtgcaactacaaa
gtgaccggtctggtagaaggactggagtatcagttcagaacatatgcgctcaatgctgca
ggggttagcaaagccagtgaagcttcacgacctatgatggctcaaaacccagttgatgca
ccaggaagaccagaggtaacagatgtcacaagatcaacagtgtcactgatttggtcttcc
ccagtgtatgatggaggcagcaagattgttggctacatcatagagcgtaagccagtcagt
gaagttggagacggtcgctggctgaagtgcaactataccattgtatctgacaatttcttc
actgtgactgctctcagtgaaggagacacttacgaattccgtgtgttggccaagaatgca
gcaggggtaattagcaagggatcagaatctacaggccccgtcacttgccgagatgaatac
gctcctcccaaagctgaactggatgccagattacagggtgatctggttaccatcagagca
ggctcggatcttgttcttgatgctgcagttggtggcaaacctgaacccaaaattatctgg
accaaaggggacaaggaactagatctctgtgaaaaaatctctttgcagtatactggcaaa
cgagcaactgctgtgatcaaattctgtgacagaagtgacagtggaaaatacactttaaca
gtgaagaatgccagtgggaccaaggccgtgtctgtcctggtcaaagttcttgattcccct
ggcccatgtggaaagctcaccgtcagcagagtaacagaggagaagtgcactttagcctgg
agccttcctcaggaagatggaggagcagaaataacacactacatcgtggaaagacgtgag
actagcaggctcaactgggtgattgttgaaggcgaatgcccaaccctatcctatgtagtt
accagactcatcaagaacaatgaatacatattccgagtgcgagcagtaaacaaatatggc
cctggtgtgcctgttgagtcagagccgattgtagccagaaactcattcactattccatca
caacctggcatgcctgaagaagttggagctggcaaagagcatatcatcattcagtgggta
aaacctgaatctgatggcggcaatgatatcagcaactacctagtagacaaacgtgagaag
aagagcttgcgctggacacgtgtcaacaaagactatgtggtgtatgataccaggctgaag
gtgactggcctgatggaaggttgtgactaccagttccgggtgactgcagtgaatgctgct
ggtaacagtgaacccagtgaagcttccaactttatctcatgcagagaaccatcatatact
cctggaccaccttctgctccaagggttgtggataccaccaagcacagcattagtttggca
tggaccaagcccatgtatgatggtggtgttgacatcacaggatatgttcttgaaatgcaa
gagaagggcactgatcagtggtaccgagtgcataccaacgccacaataagaaatactgaa
ttcactgtgctagaccttaaaatgggccagaaatattccttcagagttgctgctgtgaac
gtgaagggtatgagtgaatatagtgagtcaaccgccgaaattgagcccgtggaaagacta
gaaataccagatcttgagcttgcagatgatctaaagaagactgtgaccctcagagctggg
gcctcattgcgcctgatggtgtctgtatctggaagaccacctcctgtcatcacatggagc
aagaaaggcattgaccttgcaagtcgggcaattattgacaccactgagagctactcttta
cttattgtggacaaagttaaccggtacgatgctggaaaatacaccattgaagccgaaaat
caatctggcaagaaatcagcaacagttcttgttaaagtatatgatactcctggtccttgt
ccttcagtgaaagttaaggaagtatccagagattctgtgaccattacttgggaaattccc
acaattgatggtggagctcctgtcaacaattacattattgagaagcgtgaagctgccatg
agagcattcaaaacagtaactaccaaatgcagcaagacactttaccgaatttctggactt
gtagaaggatgcatgtactatttcagagtgttgccagaaaatatctatggcattggagaa
ccttgtgaaacatctgatgcagttctagtctccgaagtacctttggtgcctacaaagcta
gaagtggtggatgtcaccaaatcaactgtgagtcttgcctgggaaaaaccactctatgat
ggtggtagccgactcactggatatgttctcgaggcctgcaaagctggcactgagagatgg
atgaaggttgccaccttaaaacccacagtcctagagcacacagttatttccttaaatgaa
ggtgaacagtacttatttagagtaagggcacaaaatgagaaaggcgtgtcagaaccaaga
gagatcgtcacagccgttactgtacaagatctcagagtgttgccaaccatcgatctttcc
acaatgcctcaaaagaccatccatgtcccagcgggcagaccagtagagctggtgatacca
atcgctggtcgcccacctcctgctgcttcctggttctttgctggttctaaactaagagaa
tcagaccgtgtcacagttgaaactcatactaaagtagctaaattaaccatccgtgaaacc
actatcagagatactggagaatacacacttgaattgaagaatgtaactggaactacttca
gagaccattaaagttatcattcttgacaagcctggtccaccaactgggcctatcaagatt
gatgaaattgaagctacttcagttaccatttcctgggaaccacctgaattggatggtggt
gctccactgagtggctatgtggtagaacaacgtgatgcccatcgtccaggatggctgcca
gtgtctgaatcagtgactagacagacatttaagtttaccagactcactgaaggaaatgag
tatgtgttccgtgtggctgcaaccaaccgcttcgggattggatcttacttgcaatctgag
gtcatagaatgtcgcagcagcatcagtattcctggacctccggaaacattacagatattt
gatgtctcccgtgatggcatgacactcacttggtatccaccagaggatgatggtggctcc
caggtgactggatatattgtggagcgcaaagaagtgagagcagatcgatgggtccgtgta
aataaagtaccagtaaccatgacacggtaccgttccactggccttattgaaggcttagaa
tatgaacaccgtgtcacagccattaatgcaagagggactggaaaaccaagtcgtccttcc
aaacccatcgttgccatggatccaattgctcctccaggaaagcctcaaaacccaagagtt
actgatacaacaaggacatcagtctccctggcctggagtgttccagaagatgaaggagga
tctaaagtcacaggttacttgattgaaatgcaaaaagtagatcaacatgaatggaccaaa
tgtaacaccaccccaaccaagattcgggagtatactctaacacacctacctcagggcgct
gagtacagattccgtgtcctagcttgtaatgctggcggacctggggagcccgccgaggta
ccaggaacagtcaaagtcaccgaaatgcttgaatatcctgattatgaactagatgaaaga
taccaggaaggtatctttgtaagacaaggtggagtcatcagacttaccataccaattaaa
ggaaaaccattcccaatatgcaaatggaccaaggagggccaagatattagtaagcgtgcc
atgattgcaacatctgaaacgcacactgagcttgtgatcaaagaagcagacagagatgat
tctggcacttacgacctggttctggaaaacaaatgtggcaaaaaggctgtttatatcaag
gtcagggtgataggaaaccccaacactccagaagggccacttgaatatgacgacatacaa
gctcgctctgtaagggtcagctggagaccacctgctgatgatggtggtgctgacatcttg
ggatacatcctcgagagacgagaagtgcctaaatctgcctggtataccattgactccaga
gtccgaggtacatctctggtggtaaaaggcctcaaagaaaacgtggagtaccatttccgt
gtttcagctgaaaaccagtttggaattagcaaacccttgaaatctgaggaaccagtcata
ccaaaaacaccactgaaccctccggagcctccaagcaatcctccagaagtactggatgtg
accaagagttctgtcagcctgtcctggtcacggcccaaagacgatggtggttctcgagtt
acaggctactacattgaacgcagggagacatcaactgacaagtgggtcagacacaacaag
actcagataaccaccacaatgtacaccgtcaccgggcttgttcctgatgctgaatatcag
ttccgcatcattgcacagaatgatgttggcctaagcgagaccagccctgcttctgaacca
gttgtttgcaaagatccatttgataagccaagccaacctggagaacttgagattctttca
atatccaaagatagcgtcactctacagtgggagaaacctgaatgtgacggtggcaaagaa
atccttggatactgggttgaatatagacagtctggagacagtgcctggaagaagagcaat
aaggaccgcatcaaggataggcaattcacgatagggggtttgctggaagctactgaatat
gaattcagggtttttgctgagaatgagactggacttagcagacctcgaagaaccgctatg
tctgtaaagactaaactaacttctggagaggccccgggagtacgcaaagaattgaaggat
gttaccaccaaattgggtgaagctgctcaactctcatgccagattgttgggaggcctcta
cctgacattaaatggtaccgattcggtaaggagctcatacaaagccggaagtacaaaatg
tcttcagatggacgcacacatacactgacagtaatgacagaggaacaagaagacgaaggt
gtctatacctgcatggctaccaatgaggttggagaagtagaaaccagtagtaagcttctt
ttgcaagcaacaccacagttccatcctggttacccactgaaagagaaatactacggtgct
gtgggttcaacacttcgacttcatgttatgtacattggtcgtccagtacctgccatcact
tggttccatggccagaaacttttgcaaaactcagaaaacattactattgaaaacacggag
cactatactcatctcgtcatgaagaatgtccaacgtaaaactcatgctgggaaatacaaa
gttcagctcagcaatattttcggaacagtcgatgccatccttgatgtggaaatacaagat
aaaccagacaaacctacaggaccaattgtgattgaagctctattgaagaactctgtggtg
atcagctggaaaccacctgcagatgatggaggctcctggatcaccaattatgtagtggag
aaatgtgaggccaaggaaggggctgaatggcaattggtgtcttcagccatctcagtgaca
acttgcagaattgtgaacctcacagaaaatgctggctattacttccgggtttcagctcag
aacaccttcggcatcagcgaccctctggaggtcccctcggttgtgatcattaagagtcca
tttgaaaagccaagtgctcccggcaaaccaatgattactgctgtcacaaaagattcttgt
gttgtggcttggaagccacctgccagtgatggaggtgcaaagattagaaattactacctt
gagaagcgtgagaagaagcagaataaatggattgctgtgacaacagatgaaattcgagaa
accgtcttttcagtgcaaaaccttattgaaggtcttgaatatgagttccgtgtgaaatgt
gaaaacctaggtggggaaagcgaatggagtgaaatatcagaacctgtcactcccagatct
gatgtcccaattcaggcaccacactttaaagaggaactcagaaatctacatgtcagatat
cagagcaatgctactttggtctgcaaagttactggtcacccgaaacctattgtgaaatgg
tacagacaaggcaaagaaatcattgcagatggattaaagtacaggattcaggagtttaag
ggtggctaccaccagctcatcattgcagctgtcacagatgatgatgccacagtttaccaa
gtcagagctaccaaccaagggggatctgtgtcgggcactgcctccttggaagtggaagtt
ccagctaagatacatttgcctaaaactcttgaaggcatgggagcagttcacgctctccga
ggtgaggtggtcagcatcaagatccctttcagtggcaaaccagatcctgtgatcacctgg
cagaaaggacaagatctcattgacaataatggccactaccaagttattgtcacaagatct
ttcacatcacttgttttccccaatggagtggagagaaaagatgctggtttctatgtggtc
tgtgctaaaaacagatttggaattgatcagaagacagttgaactggatgtggctgatgtt
cctgacccacccagaggagtcaaagttagtgacgtctcacgagattctgtcaacttaaca
tggactgagccagcttctgatggcggcagcaaaatcaccaactacattgttgaaaagtgt
gcaactactgcagaaagatggatccgtgtaggacaggcccgagaaacccgttataccgtg
atcaacttatttggaaaaacaagttaccagttccgtgtcatagctgaaaataaattcggc
ctgagcaagccttctgagccttcagaacctactataaccaaagaagataagaccagagct
atgaactatgatgaagaggtagatgaaaccagagaagtttccatgactaaagcatctcac
tcttcaaccaaggagctctatgagaaatatatgattgccgaagatctcgggcgtggtcag
tttggaatcgtccaccgttgtgttgaaacttcctcaaagaagacatatatggccaaattt
gttaaagtcaaagggactgatcaggttttggtaaagaaggaaatctccatcctaaacatc
gctaggcacagaaacatcttatacctccatgaatcatttgaaagcatggaagaattagtc
atgatctttgagttcatatcaggacttgacatatttgaacgcattaacacaagtgctttt
gaacttaatgaaagagaaattgtaagttatgtccgccaggtctgcgaagcacttgagttc
ttacatagtcataatattggacactttgacattaggccagacaatatcatttaccaaaca
agaaggagctccgtcattaaaatcatagaatttggtcaagcccgtcagctgaagccaggg
gacaactttaggcttctgttcactgcccctgaatactatgcccctgaagtccaccaccat
gatcttgtcagcacagccacagacatgtggtcacttggaacactggtctatgtgctgttg
agtggtaccaatccattcctggctgaaactaaccaacagataattgagaacatcatgaat
gctgaatttacttttgatgaagaagcattcagagagattagccttgaagccatggatttt
gttgaccggctgttggtgaaagagagaaaatctcgcatgacagcatctgaggcactccag
cacccatggctgaagcagaagacagaaaaagtcagtactaaagttatcagaacattaaaa
caccggcgttactatcacaccctgatcaagaaagatctcaacatggttgtatcagcagcc
cggatctcctgtggtggtgcaattcgatctcagaagggagtgagtgttgctaaagttaaa
gtagcatccattgaaattggcccagtttctgggcagataatgcatgcagttggcgaagaa
ggaggatatgtcaaatatgtatgcaaaattgaaaattatgatcagtctacccaagtgacc
tggtactttggtgtcagacagctggagaacagtgagaaatatgaaatcacctatgaagat
ggcgtggccaccatgtacgtcaaacatattaccaaattcgatgacggcacctacagatgc
aaagtagtcaatgactatggcgaagacagttcttatgcagagctatttgttaaaggtgtg
agagaagtttatgactattactgccgtagaactatgaagaaaattaagcgcagaactgat
acgatgagactcctagaaaggccaccagaatttaccctgcctctctataacaagacagct
tatgtgggtgaaaatgtccggtttggagtaaccataaccgtccacccagagcctcgtgta
acatggtataagtcaggtcagaaaatcaaaccagatgatgatgacaagaagtacaccttt
gaatctgacaagggtctttaccaattaacaatcagcagtgtaactctagaagacgatgct
gagtatactgttgtcgcaaggaacaaatatggtgaagacagctgtaaagcaaagctgact
gtaaccccacacccacctccaacagatacaaccttaagacccatgttcaaacggctactg
gcaaacgcagaatgccaagaaggccaaagcgtctgcttcgagatcagagtgtctggcatc
cctgcaccaacgctaaaatgggagaaagacggtcagccgctgtcccttgggcccaacatt
gaaattatccacgaaggcttggactattatgctttgcacatcagggatactttgcctgaa
gacacaggttattatagggtcacagccacaaacacagcaggatctaccagctgccaggct
cacctacaagtggaacgcctgaggtacgtcaaacatgaatacaagagcaaggaggagcgc
gaacgacacgtacaaaggcaaattgacaagacactaagaatggctgaaattctttctgga
actgaaagtgtgccactgacacaggtagcccaagaggctctgagagaagctgccatcctt
tacaaaccagctataagcaccaagactgtaaaaggggaattccgacttgagacggaagaa
aagaaggaggagagaaaactccgtatgccttatgaggtaccagagccacgcaagtacaag
cagactaccatagaagaagaccaacacattaagcagtttgtgcctatgtctgacatgaaa
tggtacaaaaagatacgtgatcaatttgaaatgcctgggaaacttgacagagttgtacag
aaaagacccaagcgcatccgcctttcaagatgggaacagttctacgtgatgcctcttcca
cgctttacagatcaatacagacctagatggcgtattcccaaactgtctcaagatgatctt
gaaatggtgagaccagcacgccggcgtacaccttctcctgattattacttttattacaga
ccgagaagacgttctcttggtgacatctcagatgaagaattactcttgcccattgatgac
tacttggcaatgaaaagaacagaagaagagaggttgcgtcttgaggaagagcttgaatta
ggtttctcagcttcacccccaagccgaagccctccacgttttgagctatccagtctgcgt
tactcttcaccacaagctcatgtcaggacggaggaaacaagaaaagacttcagatattca
acctatcacatcccagtgaaggctgagactagtacaagttacgcggaactgcacgaacgg
catgcccgggcctcctatagacagccgaaacaacggcaaaggatcatggctgagaaggag
gatgaagagttgcttcgtccagttactaccacccagcgtctctcagcatacaaaagcgag
cttgaccacatatcaaaggaagaaaagtctagaaagaaatcaagacaacagagagaagtg
acagaaataacagaaattgaggaagaatacgaaatctcaaaacatgctcaaagagagaca
tcctcatctgtgtctagactgctgagacgacggcgctccctgtctccaacttacattgag
ttaatgaggccagtgtccgagctgatccggcgacgtccacagccggctgaggaatatgaa
gacgaatatgaagacgacacagaaagaaggtctcctactccagagagaactcgcccacgt
tcccccagccccgtgtctagtgagagatcactctcaagatttgagaggtctgcaagattt
gatatcttttccaggtatgagtccatgaaagctgctttaaagactcagaagacctcagaa
aggaagtatgaagttttgactcagcagccttttacgctggaccatgcccctcgaatcaca
ttgagaatgcgctcccacagggtaccatgtggccaaaatacatgttttatcttaaacgtt
cagtctaagccaactgccgaggttaaatggtaccataatggtgtagaactccaagagagc
agtaagattcgttacaccaacatgagtggggtactgaccctggaaattctggactgtcat
attgatgacagtggaacataccgtgctgtgtgcaccaactacaaaggtgaagcttctgac
tatgcgaccttggacgtaacgggaggggattacaccacctatgcttcccagcgcagagac
gaagatgtcccccgatctgttttccctgagctgacaagaatagaggcatatgcggtgtct
tcatttaagaaaacatctgagatggaagcttcttcttcagtcagggaaatgaaatcacag
atgacagagacaagggaaagtctctcatcatatgaacaccatgcatctgcagaaatgaaa
agcgctgcaatagaagaaaagtcgctggaagaaaaatccacacacagaaagatcaagaca
actttggcagcaagaattctaaccaagccaaggtccataactgtctatgaaggcgagtcc
gcaaggttttcttgtgatacagatggtgagccagtaccaactgtgacctggctgcgtgga
ggacaagtgatcagtacttccgcccgccaccaagtgaccaccacaaagtacaaatcgacc
tttgagatctcttcagtccaggcttccgacgagggcaactacagcgtggtggtggagaac
agtgatgggaagcaagcagcacagtttaccctgactattcaaaaggcccgggtgaccgaa
aaggctgtgacagcaccaccaagagtcaaatccccagagcctcgggtgaaatctccagaa
ggagttaagtctccaaaacgagtgaaatccccagaaccagtgacttctcacccaaaagct
gtctcaccaacagagacaaaacccacaccaacagagaaactccagcagctcccagtctct
gccccacccaggataactcagtccctgaaagcagaagcttctaaagatattgcaaagctg
acctgtgcagtcgaaagtagtatattatctgcaaaagaggtcacctggtataaagatggc
aagaaactgagggaaaatggacatttccagtttcattattcggcagatggtacctatgag
ctcaaaatccataacctcactgaatccgattgtggagaatacgtttgtgagatttctggt
gaaggtggaagttccaaaactaacttccagtttacgggacaagcctttaagagtatccat
gagcaggtatcaagcatagcagaaactaagaaatcagctcagaaaactgctgagtcaaca
gaaaccaagaaatcagttcagaaaactgctgagtcgacagaaaccaagaaaacagctcag
aaaaccactgagtcgacagaaaccaagaaaacagctcagaaaactgctgagtcaacagaa
accaagaaaactgagccaaaagctccggaaccaatttcctcaaaaccagtaattgttact
gggctacaggatacaaccgtttcttcagatagcactgctaaatttgcagttaaggttacc
ggagaaccccggccagctgtcatctggacaaaagatggaaaggctattacacaaggaggt
aaatataaactctctgaagacaaaggaggattcctcctagaaattcataagactgagacc
tctgacggcgggctttatacttgcacaataacaaattcagccggctctgtgtcctctagc
tgcaaattaacaataaaagctgtaaaagacactgaggcgcagaaagtatccacacaaaag
acctctgaaattacatcccaggagaaggcagtagtccaggaagaaatttcccaaaaagcc
ctaatttctcaagaaatcaagaagtcagaggtgaaatctcaggaaaagttagccatgaag
gaggaagcttcaaaggttctgatttctgaaaaagtcaagaaatcagaagcagcttccctg
gataaatccattgtccatgaggaaatctctaaaacatcacaggcatccgaagaaatcaga
actcaggccgaggtgaaggcattctctactcagatgagcataaatgatggtcagaaagtg
actttaaaagccaacattgctggagccactgatgtgaaatgggtactgaatggagtagag
ctaactaactccgaggagtacagatacggtgtctcaggcagcgatcagaccctaaccatc
aagcaggccggtcacaaagatgcaggaatcctcacctgcatcggcaaaaccagccaagga
atcgtcaagtgtcagtatgatctgaccctgagcaaagaactctcagatgctccagccttc
atctcacagcccagatctcaaaacgttaacgaaggacaaaatgttctcttttcttgtgaa
atcagtggcgagccatccccagaaatcgaatggtttaaaaacaacctcccgatttccatt
tcttcaaatatcagcgtaagtcgctctagaaatgtatattctcttgaaatccgaaatgca
tctgaaagcgacagtgggaagtacacagttaaggccaaaaatttccgtggccagtgctca
gctactgcttctctgacggtccttcctctagttgaagaaccttccagagaggtagtattg
aggacaagtggtgacacgagcttgcacggaagcttctcgtctcagtcaatgcaaatgtcg
gcctctaagcaggaggcctccttcagcagtttcagcagcagcagtgctagcagcatgact
gaaatgaaatttgcaagcatgtctgcccaaagcatgtcctccatgcaggagtcctttgta
gaaatgagttccagcagttttatgggaaaagctagcatgacgcaactggaaagctcaact
agtagaatgcttaaagcaggcataagaggagttccacctaaaattgaagctcttccctct
gacatcagcattgatgagggcaaagttttaacagtagcctgtgcttttacgggtgagcct
actccggaaataacgtggtcctgtcgtggaagaaaaattaaaaatcaagaacaacaaggg
agattccttattgaaaacacagatgacctgacaactctgatcatcatggacgtacagaaa
caagatggtggaatttataccctgagcttagggaatgaattcggatctgactctgccact
gtgaatataaatattcgatccatttaa

DBGET integrated database retrieval system