KEGG   Equus asinus (ass): 106827198Help
Entry
106827198         CDS       T04645                                 

Gene name
CAMK1G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IG
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
eai  Equus asinus (ass)
Pathway
eai04020  Calcium signaling pathway
eai04921  Oxytocin signaling pathway
eai04925  Aldosterone synthesis and secretion
eai05214  Glioma
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    106827198 (CAMK1G)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    106827198 (CAMK1G)
   04925 Aldosterone synthesis and secretion
    106827198 (CAMK1G)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    106827198 (CAMK1G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eai01001]
    106827198 (CAMK1G)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     106827198 (CAMK1G)
Protein kinases [BR:eai01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   106827198 (CAMK1G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo Pkinase_fungal APH RIO1 CsgA
Motif
Other DBs
NCBI-GeneID: 106827198
NCBI-ProteinID: XP_014690429
Position
Un
AA seq 476 aa AA seqDB search
MGRKEEDDCSSWKKQTTNIRKTFIFMEVLGSGAFSEVFLVKQRVTGKLFALKCIKKSPAF
RDSSLENEIAVLKKIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDA
SLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKMEQSGVMSTAC
GTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFES
PFWDDISESAKDFICHLLEKDPNVRYTCEKALRHPWIDGNTALHRDIYPSVSLQIQKNFA
KSKWRQAFNAAAVVHHMRKLHMNLHSPGVRPEVENRPPVPQASEALRPSSPEITITEAPA
LDQNVALPALTRLPCKHSPRPTAPGGRSLNCLVNGSLRISSSLVPMRQGPLAIGPCGCCS
SCLSIGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVKASGSSHCRAGQTGVCLIM
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgaaaggaagaagatgactgcagctcctggaagaaacagaccaccaacatccgg
aaaaccttcatcttcatggaagtgctgggctcaggagctttttccgaagttttcctggtg
aagcaaagggtgactgggaagctctttgccctgaagtgcatcaagaagtcccctgccttc
cgggacagcagcctggagaatgagatcgccgtgttgaaaaagatcaagcatgaaaacatc
gtgaccctggaggacatctacgagagcaccacccactactacctggtcatgcagcttgtt
tctggtggggagctctttgaccggatcctggagcggggtgtctacacagagaaggatgcc
agcctggtgatccagcaggtcttgtcagcagtgaaatacctccacgagaatggcatcgtc
cacagagacttaaagcctgaaaacctgctgtacctcactcctgaagagaattctaagatc
atgatcacagactttggtctgtctaagatggagcagagtggtgtcatgtccaccgcctgc
gggaccccaggctatgtggctccggaagtattagcccagaaaccctacagcaaggccgtg
gattgctggtccattggcgtcatcacttacatattgttgtgtgggtatcctcctttctat
gaagaaactgagtctaagctttttgagaagatcaaggagggctactatgagtttgagtct
ccattctgggatgacatttcggaatcagccaaggattttatttgccacttgctggagaag
gacccaaacgtgcggtacacctgtgagaaggccttgaggcacccctggattgacggaaat
acagctctccatcgggacatctacccgtcagtcagcctccagatccagaagaactttgcc
aagagcaagtggaggcaagccttcaatgcagcagccgtggtgcaccacatgaggaagctg
cacatgaacctgcacagcccgggtgtccggccagaggtggagaacaggccgcccgtccct
caagcctcagaggctttgagacccagctcccctgagatcaccatcaccgaggcacccgcc
ctggaccagaatgtggcactccctgccctgacccggctgccctgcaagcacagccccagg
cctactgcccccgggggcaggtccctcaactgcctagtcaatggctccctccgcatcagc
agcagcctggtgcccatgcggcaggggcccctggccatcgggccctgcggctgctgctcc
agctgcctgagcattgggagcaaagggaagtcctcctactgctccgagcccacactcctt
aaaaaggccaacaaaaaacagaacttcaaatcagaggtcatggtgccagtcaaagccagt
ggcagctcccactgccgggcggggcagactggagtctgtctcattatgtga

DBGET integrated database retrieval system