KEGG   Equus asinus (ass): 106827579Help
Entry
106827579         CDS       T04645                                 

Gene name
NIT1
Definition
(RefSeq) nitrilase 1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
eai  Equus asinus (ass)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106827579 (NIT1)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     106827579 (NIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 106827579
NCBI-ProteinID: XP_014690985
Position
Un
AA seq 345 aa AA seqDB search
MTFELQKRLAEERGFRLMLGFIIRPPHQFLSLLLCPGLRIPPLSVLCAQPRPRTMAVSSS
SWELPLVAVCQVTSTPDKQQNFKTCAELVREAARLGACLAFLPEAFDFIARDPAETLRLS
EPLDGNLLGEYTQLARECGLWLSLGGFHERGQDWEQTQKIYNCHVLLNSKGSVVATYRKT
HLCDVEIPGQEPMRESNSTLPGPSLESPVSTPAGKVGLAICYDMRFPELSLALAQAGAEI
LTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQYGCHHEKRASYGHSMVVDPWGTVV
ARCSEGPGLCLARIDLNYLRQLRQHLPVFQHRRPDLYGNLGHPLS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgaactgcagaaacgtttggcagaggaacggggcttcaggctaatgctgggc
ttcatcatcaggcctcctcaccagttcctgtcccttcttttgtgtcctggcctccggata
cctcctctttcagtactttgtgctcagcccagacccagaaccatggctgtctcctcttcc
tcctgggaactgccccttgtggctgtgtgccaggtaacatcaacaccagacaaacagcag
aactttaaaacatgtgctgagctggttcgagaggctgccagactgggcgcttgcctggct
tttctgcctgaggcatttgacttcattgcacgagaccctgcagagacgctacgcctgtct
gagccactggatgggaaccttttgggagaatatacccagcttgccagggaatgtggactc
tggctgtccttgggtggtttccatgagcgtggccaagactgggagcagactcagaaaatc
tacaattgtcatgtgcttctgaacagcaagggatcagtagtggccacttacaggaagaca
cacctgtgtgacgtcgagattccagggcaggagcctatgcgtgaaagcaattctaccctg
cctgggcccagtctcgagtcacctgtcagcacaccagcaggcaaggttggtctcgctatc
tgctatgacatgcggttccccgaactctctctggcattggctcaggctggagcagaaata
cttacctacccttcagcttttggatctataacaggcccagcccactgggaggtattgctg
cgggcacgagccattgaaacccagtgctatgtagtggcagcagcacagtatggatgccac
catgagaagagagcaagttatggccacagcatggtggtggatccctggggaacagtggtg
gcccgctgctctgagggaccaggcctctgccttgcccgaattgacctcaattatctgcga
cagttgcgccaacacctgcctgtattccagcaccgcaggcctgatctctatggcaatctg
ggtcacccactgtcttaa

DBGET integrated database retrieval system