KEGG   Equus asinus (ass): 106828170Help
Entry
106828170         CDS       T04645                                 

Gene name
IDH1
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 1, cytosolic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
eai  Equus asinus (ass)
Pathway
eai00020  Citrate cycle (TCA cycle)
eai00480  Glutathione metabolism
eai01100  Metabolic pathways
eai01200  Carbon metabolism
eai01210  2-Oxocarboxylic acid metabolism
eai01230  Biosynthesis of amino acids
eai04146  Peroxisome
Module
eai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eai_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106828170 (IDH1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106828170 (IDH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106828170 (IDH1)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     106828170 (IDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 106828170
NCBI-ProteinID: XP_014691908
Position
Un
AA seq 414 aa AA seqDB search
MSQKIRGGSVVEMQGDEMTRIIWELIKEKLIFPHVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGRVEITYTPSDGSQKRTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKSWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYRSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELGFFAKALE
DVCVETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaaaaatccgtggcggttctgtggtagagatgcaaggagatgaaatgacgcga
atcatctgggagttgattaaagaaaaactcatttttccccacgtggagctggacttgcac
agctatgatttaggcatagagaatcgagatgccaccaatgaccaggtcactaaggatgcc
gcagaagccataaagaagtacaacgtgggtgtcaagtgtgctaccatcacccctgacgag
aagagggttgaggagttcaagctgaagcaaatgtggaaatcgccaaacggcaccatccga
aatatcctgggtggcactgtcttcagggaggccattatctgcaaaaacatcccccggctg
gtgagcgggtgggtgaaacccatcatcataggtcgtcatgcttatggggaccaatacaga
gcaaccgattttgttgttcctgggcccggaagagtagagataacctacacaccgagtgat
ggatcccagaaaaggacctacctggtacataactttgaagagggcggcggcgtggccatg
gggatgtacaatcaagacaagtccattgaagattttgcacacagctctttccagatggct
ctgtctaagagctggcccctgtatctgagcaccaagaacactattctgaagaaatacgac
ggacgtttcaaagacatctttcaggagatatatgacaagcagtacagatcccagtttgaa
gcccagaagatctggtatgagcataggctcatcgatgacatggtggcccaagctatgaag
tcggagggcggcttcatctgggcctgtaagaactacgacggcgacgtgcagtcagactcc
gtggcccaaggatatggctctcttggcatgatgaccagcgtgctggtttgtccagatggc
aagaccgtggaagcagaggctgcgcacggcaccgtgacacgccactaccgcatgtaccag
aaaggacaggagacgtccaccaaccccatcgcttccatttttgcctggaccagagggttg
gcccacagagccaagctcgataacaacaaagagctcggcttcttcgcaaaggccttggaa
gacgtctgcgttgagaccattgaggctggcttcatgaccaaggacttggctgcttgtatt
aaaggtttacccaacgtgcagcgttccgactacctgaatacgtttgaattcatggacaag
ctcggagaaaacttgaagataaaactggcgcaggccaaactctga

DBGET integrated database retrieval system