KEGG   Equus asinus (ass): 106828495Help
Entry
106828495         CDS       T04645                                 

Gene name
GBA
Definition
(RefSeq) glucosylceramidase beta
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
eai  Equus asinus (ass)
Pathway
eai00511  Other glycan degradation
eai00600  Sphingolipid metabolism
eai01100  Metabolic pathways
eai04142  Lysosome
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106828495 (GBA)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    106828495 (GBA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106828495 (GBA)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     106828495 (GBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-GeneID: 106828495
NCBI-ProteinID: XP_014692526
Position
Un
AA seq 536 aa AA seqDB search
MELSSPSREGCLKCPGRVGIMAASLMGLLLLQAVSRASGARPCSPKSFGYSSVVCVCNAT
YCDSLDPLTLPAPGTFSRYESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKGF
GGAMTDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRVYTYADTPDD
FQLHNFSLPEEDVKLKIPLIHQALELAQRPISLFASPWTSPTWLKTNGAVNGKGSLKGQP
GDRYHQTWAKYFVKFLDAYAEHKLQFWAVTTENEPSAGLISGYPFQCLGFTPEHQRDFIA
RDLGPTLANSTHRNVRVLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAK
ATLGETHRLFPDMMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVAGWTDW
NLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLDASEK
TNLDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETVSPGYSIHTYLWRRQ
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggagctttcaagtccttccagagaggggtgtctcaagtgcccgggcagggtaggcatc
atggctgccagcctcatgggattgcttctacttcaggcagtatcacgggcatcaggtgcc
cgcccctgcagccctaaaagctttggctacagctcggtggtctgtgtctgcaatgccacg
tactgtgactctcttgaccccctgaccctgcctgcccctggcaccttcagccgctatgag
agcacacgcagtggtcgccgaatggagctgagtctggggaccatccaggccaaccgcaca
ggcacagggttgctactgaccctgcagccagatcagaagttccaaaaagtgaagggattt
ggaggggccatgacagatgctgctgctctcaacatccttgccctgtcacctgctgcccgg
aatttgctactcaaatcatacttctctgaagaaggaatcgaatacaatatcatccgggta
cccatggccagctgtgacttctccattcgtgtatacacctatgccgacacccctgatgac
ttccagttgcacaacttcagcctcccagaggaagatgtcaagctcaagatacccctgatt
caccaggccctggagttggcccagcgccccatctcactcttcgccagtccctggacatca
cccacttggctcaagaccaatggggcagtgaatgggaaggggtcactcaagggtcagccg
ggagatcgctaccaccagacctgggccaaatactttgtcaagttcctggatgcctatgct
gagcacaagttacagttctgggcggtaacaactgagaacgagccttctgcagggctcatt
agtgggtaccccttccagtgcctgggcttcacccctgaacaccagcgagacttcatcgcc
cgtgacctgggtcccacccttgccaacagtacgcaccgcaatgtccgtgtgctcatgctg
gatgaccaacgcctgctgctgccccgctgggcccaggtggtgctggcggacccagaggca
gccaaatacgttcatggcattgctgtacactggtatctggactttctggctccagcaaaa
gccaccctgggggagacacaccgcctgttccctgacatgatgctctttgcctcagaggcc
tgtgtgggctccaagttctgggagcagagtgtgcgcctaggctcctgggatcgagggatg
cagtacagccacagcatcatcacgaacctcctctaccatgtggctggctggaccgactgg
aacctcgccctgaaccctgaagggggacccaactgggtgcgcaactttgtcgacagcccc
atcatcgtggacatcgccaaggacacgttttacaaacagcccatgttctaccaccttggc
cacttcagcaagttcattcctgagggctcccagagagtggggctggatgccagtgagaag
accaacttggacacagtggcactgatgcatcccgatggctctgcagttgtggtcgtgcta
aaccgctcctctaaggatgtgcctctcaccatcaaggatcctgccgtgggattcctggag
actgtctcacctggctactccattcacacctacctgtggcgtcgccagtga

DBGET integrated database retrieval system