KEGG   Equus asinus (ass): 106829258Help
Entry
106829258         CDS       T04645                                 

Gene name
PRODH2
Definition
(RefSeq) proline dehydrogenase 2
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
eai  Equus asinus (ass)
Pathway
eai00330  Arginine and proline metabolism
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    106829258 (PRODH2)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     106829258 (PRODH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 106829258
NCBI-ProteinID: XP_014693767
Position
Un
AA seq 460 aa AA seqDB search
MLWTCRVLCPQAGPSAGGWQPLSFDGGAFHLKRTGELTRALLVLRLCAWPPLVTHGLALQ
AWSHRLLGSRLSGALLRASIYGQFVAGETTEEVRGCVQQLQTLCLRPLLAVPTEEEPDSA
VKTGEAWYEGNLSAMLRCVDLSRGLLEAPGPTGNILMQLKMTALTSTRLCKELTSWVRRL
GASWELSPERLAEAMDSGRGLQISCLNAEQNQHLQASLSRLHRVAQHARAQRVWLLVDAE
YTSLNPALSLLVAALAERWNRPGEGGPWVWNTYQAYLKDTHERLRRDAEAADRAGLAFGV
KLVRGAYLDKEREVARLQGTQDPTQPDYEATNQSYSRCLELMLAHVSHRGPMCHLMVASH
NEESVQQATKRMWELGIPLDGPVCFGQLLGMCDHVSLALGQAGYAVYKSIPYGSLEEVIP
YLIRRAQENRSVLRGARREQELLSQELRRRLLGRGLGGPR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctctggacgtgccgagtgctctgtccccaagccggcccctccgctgggggctggcag
cccctcagctttgacgggggggccttccacctcaagcgcacaggagagctcacacgggct
ttgctggtgctacggctgtgtgcctggccccctctggtcacccatgggctggcgctccag
gcctggtctcatcgcctcctgggctcccggctctcgggcgcacttctccgagcatccatc
tacgggcagtttgtggctggtgagacgacagaggaggtgaggggctgtgtccaacagctc
cagaccctctgcctccggcccctgctggcagtacccactgaggaggagccggactcggct
gtcaagactggtgaggcctggtacgaaggcaacctcagcgccatgctacggtgcgtggac
ctgtcacgagggctcctggaggccccaggcccgactgggaacatcctcatgcagctgaag
atgacggcgctgaccagcactcggctctgtaaggagctaacctcatgggtcagaaggctg
ggggcttcctgggagctgagccccgagaggctggcagaagccatggactctgggcggggc
ctccagatctcttgcttgaatgccgagcaaaaccagcatctccaggcttctctgagccgc
ctgcaccgggtggcacagcatgcccgggcccagcgcgtgtggctcctggtggatgctgag
tacacctcgctgaaccctgccctgtctctgctggtggccgccctggccgagcgctggaac
cgccccggggaaggcgggccctgggtgtggaacacctaccaggcttatctgaaggacaca
cacgagcggctgaggcgggatgctgaggctgcagacagggctggcctggcctttggagtg
aagttggtccgaggggcgtatctggacaaggagagagaggtggcccggctccaggggacc
caagatcccactcagcctgactacgaggctaccaatcagagttacagccgctgtctggag
ctgatgctggcccatgtgtcccaccgtggccccatgtgtcacctcatggtggcttcccac
aatgaggaatctgttcaacaggcaaccaagcgcatgtgggagctgggcattcctctggat
gggcctgtctgttttggacaacttctggggatgtgtgaccacgtctccctggcactgggg
caagccggctacgctgtgtataagtccatcccctacggctccctggaggaggtgatcccc
tacctgatccggagggcccaggagaaccggagtgtgctgcggggcgcccgcagggaacag
gagctgctcagccaagaacttcggcggaggctgctggggcggggcctaggcggaccccgt
tag

DBGET integrated database retrieval system