KEGG   Equus asinus (ass): 106829631Help
Entry
106829631         CDS       T04645                                 

Definition
(RefSeq) cytosolic beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
eai  Equus asinus (ass)
Pathway
eai00500  Starch and sucrose metabolism
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106829631
Enzymes [BR:eai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     106829631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase REC1
Motif
Other DBs
NCBI-GeneID: 106829631
NCBI-ProteinID: XP_014694333
Position
Un
AA seq 469 aa AA seqDB search
MAFPAGFGWGAATAAYQVEGGWDADGKGPSVWDTFTHQGGERVFKNQTGDVACGSYTLWE
EDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLTNGVTPIVTLYH
FDLPQALEDQGGWLSEATIESFDKYARFCFSTFGDRVKQWITINEPNIYAMLGYELGIFP
PGVPHSGTGGYQAAHNMIKAHARSWHSYDSLFRKDQKGMVSLSIFAGWAEPADPNSVSDQ
EAAKRAISFCLDFIAKPIFIDGDYPEVVKSQVASMSKKQGYPSSRLPEFTEEEKRMIKGT
ADFFAVQYYTTRLVKYQENKKGELGILQDAETEILTDPSWISLDWVYVVPWGIRKLLKYI
KDTYNNPVIYITENGFPQLDPVSLDDTQRWEYFRQTFQELFKAIQLDKVNLKVYCAWSLL
DNFEWDRGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIQKNGLEGDA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggctttccctgcaggatttggatggggggcagccacggcagcctatcaagtggaagga
ggctgggatgcagatggaaaaggccctagtgtctgggacacattcacccatcagggagga
gagagagttttcaagaaccagactggcgatgtagcttgtggcagctacactctgtgggag
gaagatttgaaatgtatcaaacagcttggattgactcattaccgcttctctctttcctgg
tcacgtctgttacctgatgggacgacaggtttcatcaaccagaaaggaattgactactac
aacaagatcattgatgatttgttaactaatggggttactcccatagtgaccctctaccac
tttgatttgcctcaggccttagaagaccaaggaggttggttgtcagaggcaaccattgaa
tcctttgacaaatatgcccggttttgcttcagtacgtttggggatagagtgaagcagtgg
atcaccataaacgagcctaatatttatgccatgctgggatatgagcttggcatatttcct
cctggtgtacctcactcaggaactggaggttaccaggcagctcataacatgattaaagct
catgccagatcctggcacagctatgattccttattccgaaaagatcagaagggtatggtg
tccctatcaatttttgctggctgggcagaaccagcagatcccaactcagtatctgaccag
gaagctgctaaaagagccatctctttctgcttggatttcattgctaaacctatatttatt
gatggtgattatcctgaagttgtcaagtcccaggttgcctccatgagtaaaaagcaaggc
tatccatcatcaagacttccagaatttacagaagaagagaagagaatgatcaaaggcact
gctgatttctttgctgtgcaatattatacgactcgcttagtcaaataccaggagaacaag
aaaggagaattgggtattttgcaggatgcggagactgaaattcttacagacccatcttgg
ataagtctggattgggtctatgtggtgccatggggaatacgtaaactactgaaatacatt
aaggatacttataataaccctgtaatttacatcactgagaatggatttccccagcttgac
cctgtatctcttgatgacactcagcgctgggagtatttcagacagacatttcaggaactg
ttcaaagctatccaacttgataaagtcaatcttaaagtatattgtgcatggtctcttctg
gacaactttgagtgggacagggggtacagcagccggtttggtctcttccacgttgatttt
gaagatccagctagaccccgagtcccttacacatcagccaaggaatatgctaagatcatc
caaaagaatggcctggagggagatgcataa

DBGET integrated database retrieval system