KEGG   Equus asinus (ass): 106830447Help
Entry
106830447         CDS       T04645                                 

Gene name
DUSP10
Definition
(RefSeq) dual specificity phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
eai  Equus asinus (ass)
Pathway
eai04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106830447 (DUSP10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eai01009]
    106830447 (DUSP10)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106830447 (DUSP10)
    3.1.3.48  protein-tyrosine-phosphatase
     106830447 (DUSP10)
Protein phosphatases and associated proteins [BR:eai01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    106830447 (DUSP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 106830447
NCBI-ProteinID: XP_014695512
Position
Un
AA seq 482 aa AA seqDB search
MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSAAPGSNSHSPVIATTVVSLKAANLTY
MPSSSGSARSLNCGCSSASCCTVATYDKDNQTQTQAIAAGTATTAIGTSTTCPANQMVNN
NENAGSLSPSGGVGSPVSGTPKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPF
MEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENT
NEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECREVGGGA
SAASSMLPQSIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPL
YHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVI
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVET
VV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgtctcccttagacgacagggtagtagtggcactgtctaggcccgtccgacct
caggatctcaacctttgtttagactctagctaccttggctctgccgccccaggcagtaac
agccactctcctgtcatcgccaccaccgttgtgtccctaaaggctgcgaatctgacgtat
atgccctcatccagcggctctgcccgctccctgaattgtggatgcagcagtgccagctgc
tgcactgtggcaacctacgacaaggacaatcagacccaaacccaagccattgccgctggc
accgccaccaccgccatcggaacctctaccacctgccctgccaaccagatggtcaacaac
aatgagaatgcaggctctttaagtccatcaggtggggtgggcagccctgtgtcaggaacc
cccaagcagctagccagcatcaaaataatctaccccaatgacttggcgaagaagatgacc
aaatgcagcaagagtcacctgccaagccagggccctgtcatcattgactgcaggcccttc
atggagtacaacaagagtcacatccaaggagctgtccacattaactgtgcagataagatc
agccggcggagactgcaacagggcaagatcactgtcttagacttgatttcctgtagggaa
ggcaaggactctttcaagaggatcttttccaaagaaattatagtttatgatgagaatacc
aatgagccgagccgagtgatgccctcccagccacttcacatagtcctcgagtccctgaag
agagaaggcaaagaacctctggtgttgaaaggtggacttagcagttttaagcagaaccat
gaaaacctctgtgacaactccctccagctccaagagtgccgggaggtggggggcggcgcg
tctgcggcctcgagcatgctacctcagtccatccccaccacccctgacatcgagaatgcc
gagctcacgcccatcttgcccttcctgttccttggcaatgagcaggatgctcaggacctg
gacacgatgcagcggctgaacatcggctatgtcatcaacgtcaccactcacctgcccctc
taccactacgagaaaggcctgttcaactacaagcggctgccggccaccgatagcaacaag
cagaacctgcggcagtactttgaagaggcttttgagttcattgaggaagctcaccagtgt
gggaagggacttctcatccattgccaggctggagtgtcccgctctgctaccatcgtcatc
gcttacttgatgaagcacactcggatgaccatgactgatgcttataaatttgtcaaaggc
aaacgaccaattatttccccaaaccttaacttcatggggcagttgctggagttcgaggaa
gacttaaacaacggggtgacaccgcgaatccttacaccaaagctgatgggcgtggaaacg
gttgtgtga

DBGET integrated database retrieval system