KEGG   Equus asinus (ass): 106830698Help
Entry
106830698         CDS       T04645                                 

Gene name
GMPPB
Definition
(RefSeq) GDP-mannose pyrophosphorylase B
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
eai  Equus asinus (ass)
Pathway
eai00051  Fructose and mannose metabolism
eai00520  Amino sugar and nucleotide sugar metabolism
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106830698 (GMPPB)
   00520 Amino sugar and nucleotide sugar metabolism
    106830698 (GMPPB)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106830698 (GMPPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Hexapep_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 106830698
NCBI-ProteinID: XP_014695922
Position
Un
AA seq 360 aa AA seqDB search
MKALILVGGYGTRLRPLTLSIPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVL
EKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSDVICDFPFQAM
VQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSP
AVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKQ
PEQLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDAHICSH
SWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactgatcttggtgggcggctatgggacgcgcctgcggccgctgacgttaagc
atcccgaagccactggtggacttctgcaataagcccatcttgctgcaccaagtggaggcg
ctggccgcggccggcgtggaccacgtgattctggccgtaagctacatgtctcaggtgctg
gagaaggaaatgaaggcgcaggagcaaaggctaggaatccgaatctccatgtcccatgaa
gaggagcctttggggacagctgggcccctggcactagctcgtgacctgctttctgagact
gcagaccctttcttcgtcctcaatagtgatgtgatctgtgatttccccttccaagccatg
gtgcagttccaccggcaccacggccaggaaggctccatcctggtgaccaaagtggaggaa
ccttctaagtacggtgtggtggtgtgtgaggctgatacaggccgcattcaccggtttgtg
gagaagccgcaggtgtttgtgtccaacaagatcaatgcaggcatgtacatcctgagccct
gcagtgctgcggcgcatccagctgcagcctacgtccattgagaaggagatcttccctgtc
atggccaaggagggacagctatatgccatggagctgcagggcttctggatggacattggg
cagcccaaggatttcctcactggaatgtgcctcttcctacagtcactgcgacagaagcag
cctgagcaactgtgctcaggccctggcattgtgggcaacgtgctggtggacccaagtgcc
cgcattggccagaactgcagcattggtcccaacgtgagcctgggtcctggtgtggtggtg
gaggatggtgtgtgtatccgacggtgcacagtgctgcgagacgcccacatttgctcccac
tcctggcttgagtcctgcattgtgggctggcgctgccgtgtgggccagtgggtgcgcatg
gagaatgtgacagtgctgggtgaggacgtcatagttaacgacgagctctacctcaatggg
gccagtgtcctgccccacaaatctattggcgagtcggtgccggagcctcgcatcatcatg
tga

DBGET integrated database retrieval system