KEGG   Equus asinus (ass): 106832775Help
Entry
106832775         CDS       T04645                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock protein family A (Hsp70) member 8
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
eai  Equus asinus (ass)
Pathway
eai03040  Spliceosome
eai04010  MAPK signaling pathway
eai04141  Protein processing in endoplasmic reticulum
eai04144  Endocytosis
eai04213  Longevity regulating pathway - multiple species
eai04612  Antigen processing and presentation
eai04915  Estrogen signaling pathway
eai05134  Legionellosis
eai05145  Toxoplasmosis
eai05162  Measles
Brite
KEGG Orthology (KO) [BR:eai00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106832775 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106832775 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106832775 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106832775 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    106832775 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    106832775 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    106832775 (HSPA8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    106832775 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    106832775 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106832775 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eai01009]
    106832775 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eai03041]
    106832775 (HSPA8)
   03009 Ribosome biogenesis [BR:eai03009]
    106832775 (HSPA8)
   03110 Chaperones and folding catalysts [BR:eai03110]
    106832775 (HSPA8)
   04131 Membrane trafficking [BR:eai04131]
    106832775 (HSPA8)
   03051 Proteasome [BR:eai03051]
    106832775 (HSPA8)
   03029 Mitochondrial biogenesis [BR:eai03029]
    106832775 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eai04147]
    106832775 (HSPA8)
Protein phosphatases and associated proteins [BR:eai01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     106832775 (HSPA8)
Spliceosome [BR:eai03041]
 Complex B
  Other components
   Prp19 complex
    106832775 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    106832775 (HSPA8)
Ribosome biogenesis [BR:eai03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    106832775 (HSPA8)
Chaperones and folding catalysts [BR:eai03110]
 Heat shock proteins
  HSP70 / DNAK
   106832775 (HSPA8)
Membrane trafficking [BR:eai04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    106832775 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    106832775 (HSPA8)
Proteasome [BR:eai03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    106832775 (HSPA8)
Mitochondrial biogenesis [BR:eai03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    106832775 (HSPA8)
Exosome [BR:eai04147]
 Exosomal proteins
  Proteins found in most exosomes
   106832775 (HSPA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 106832775
NCBI-ProteinID: XP_014699146
Position
Un
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggacctgcagttggcattgatcttggcaccacctactcgtgtgtgggtgtt
ttccagcatggaaaagtggaaataatagccaatgatcaaggaaaccgaaccaccccgagc
tatgtcgcttttactgacacggaacgattgatcggtgatgctgcaaagaaccaagttgca
atgaacccgaccaacacggtttttgatgccaaacgtctgattggacgtagatttgatgat
gctgttgtccagtctgatatgaagcattggcccttcatggtggtgaatgatgcaggcagg
cccaaggtccaagtagaatacaagggagagacaaaaagtttctatccagaggaggtgtct
tctatggttttgacaaagatgaaggaaatcgcagaagcctaccttgggaagactgttacc
aatgctgttgtcacagtacctgcttactttaatgactctcagcgtcaggctaccaaagat
gctggaactattgctggtctcaatgtacttagaatcatcaatgagccaactgctgctgct
attgcttacggtttagacaaaaaggttggagctgagagaaacgtactgatctttgactta
ggaggtggcacttttgatgtgtcaatcctcactattgaagatggaatctttgaggtcaaa
tctacagctggagacacccacttaggtggagaagactttgacaaccgaatggtcaaccat
tttatcgcagaattcaagcgcaagcataagaaggacatcagtgagaacaagagggccgtc
cgacgcctgcgcactgcttgtgaacgtgctaagcgtactctctcttctagcacccaggcc
agtattgagattgattcactctatgaaggaatcgacttctatacctctattacccgtgcc
cgatttgaagaattgaatgctgacctgttccgtggcaccctggaccctgtagagaaagcc
cttcgggatgccaagctggacaagtcccagattcatgatattgtcctagtgggtggttct
acccgcatccccaagattcagaaacttctacaggacttcttcaatggaaaagaactgaat
aagagcatcaaccctgatgaggctgttgcttatggtgcagctgtccaggcagccatccta
tctggagacaaatctgaaaatgttcaagatttgctgctgttggatgtcactcctctttcc
cttggcattgaaactgctggtggagtcatgactgtgctcataaagcgcaacactacgatt
cctaccaagcagacacaaaccttcactacctactctgacaaccagcctggtgtgctcatt
caggtttatgaaggtgagcgtgccatgaccaaggataacaatctgcttggcaagtttgaa
ctcacaggcatacctccagcccctcgtggtgttcctcagattgaagtcacttttgatatt
gatgccaatggcattctcaatgtctctgctgtggacaagagtacagggaaagaaaacaag
atcaccatcactaacgacaagggtcgtttgagcaaggaagacatagagcgcatggtccag
gaagctgagaagtacaaggctgaagatgaaaagcagcgggacaaggtgtcttctaagaat
tcacttgagtcctatgcattcaacatgaaagcaactgttgaagatgaaaaacttcaaggc
aagatcaatgacgaggacaaacagaagattcttgacaagtgcaatgaaatcatcaactgg
cttgacaagaaccagactgcagagaaggaagaatttgaacatcagcagaaagagctggag
aaagtttgcaaccccatcattaccaagctgtaccagagtgcaggaggcatgccaggagga
atgcctgggggtttccctggtggtggagctcctccatctggtggtgcctcctctggaccc
accattgaagaggtggattaa

DBGET integrated database retrieval system