KEGG   Equus asinus (ass): 106833174Help
Entry
106833174         CDS       T04645                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
eai  Equus asinus (ass)
Pathway
eai00480  Glutathione metabolism
eai00590  Arachidonic acid metabolism
eai01100  Metabolic pathways
eai04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106833174 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106833174 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    106833174 (GPX7)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     106833174 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 106833174
NCBI-ProteinID: XP_014699781
Position
Un
AA seq 186 aa AA seqDB search
MVAALVAAWLLLAVAARAQREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVV
GTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEIRPHITELVRKLIL
KKREDL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtggctgcactggtggcggcgtggctgctcctggcggtcgcggcccgcgcgcagcgg
gagcaggacttctacgacttcaaggcggtcaacatccggggcaagctggtgtcgctggag
aagtaccgcgggtcggtctccctggtggtgaacgtggctagcgagtgcggcttcacagac
cagcactaccgagccctgcagcagctgcaacgggacctggggccccaccacttcaacgtg
cttgccttcccctgcaaccagtttggccagcaggagcctgacagcaacaaggagatcgag
agctttgcccgccgcacctatagcgtctctttccccatgtttagcaagattgcagtcgtc
ggcactggagcccaccctgccttcaagtacctgacccagacttctgggaaggagcccacc
tggaacttctggaagtacctagtggccccagatgggaaggttgtaggggcttgggatcca
accgtgtcggtggaggagatcagaccccatatcacagaacttgtgaggaagctcatcctg
aagaagcgagaagacttgtaa

DBGET integrated database retrieval system