KEGG   Equus asinus (ass): 106833526Help
Entry
106833526         CDS       T04645                                 

Gene name
DPP3
Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
eai  Equus asinus (ass)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eai01002]
    106833526 (DPP3)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     106833526 (DPP3)
Peptidases [BR:eai01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   106833526 (DPP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 106833526
NCBI-ProteinID: XP_014700253
Position
Un
AA seq 757 aa AA seqDB search
MGEPEAGSEFAIGAAAAAGPMADTQYILPNDIGVSCLDCREAFRLLSPTERLYAHHLSRA
AWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVY
SNMGNYKSFGDTKFVPNLPKEKLERVILGSKAAQQHPEEVRGLWQTCGELMFSLESRLRH
LGLGKEGITTYFSGDCTMEDAKLAQDFLDSQNLSAYNTRLFKEVGQDGQPRYEVRLASVL
GAEPALDSEMTSKLKSYTFRGSHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQ
YIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKAMS
AKFEWLVASAEQLLKELPWPPAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQ
TEGFKNVSLGNVLAVSYTTQREKLTFLEEDDKDLYIRWKGPSFDVQVGLHELLGHGSGKL
FVQDEKGAFNFDQDTVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCL
NPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPETASWRQAHMQARFVILRVLL
EAGEGLVTVTPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRAL
YEGYAAVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSEVQLLEYEASAAGLIQSF
SERFPEDGPELEEVLTQLATADARFWKGPSEAPSGQA
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgggggagccggaagcaggaagtgagtttgcaatcggagcagctgcagcagcagggccc
atggcggacacccagtacatcctgcccaatgacatcggcgtgtcttgcctggactgtcgt
gaggccttccgcctgctgtcgcccacagagcgcctctatgcccaccacctgtcacgggcc
gcctggtacggaggcctggctgttctgctgcagacctcccctgaggccccctacatttat
gccctgctcagccgcctcttccgtgcccaggaccccgaccagctgcgccagcatgccctg
gctgagggccttacagaggaggagtatcaggcgttcctggtctatgccgcgggtgtctac
tccaacatgggcaactacaagtccttcggcgacaccaagtttgtgcccaacctgcccaag
gagaagctggaacgtgtgatcctagggagtaaggctgctcagcagcatccagaagaagtc
aggggcctctggcagacctgcggggagctcatgttctctctggagtccaggcttcgacac
ctcgggctgggaaaggaggggatcaccacctatttctctggggattgtaccatggaagat
gccaaactggcccaagactttctggactcacagaacctcagtgcctacaacacacggctc
ttcaaggaggtcggccaggatgggcagccccgctacgaggtgcggttggcttccgtgctt
ggcgcagagcctgctctggactccgaaatgacttccaagctgaagagctacacattccgg
gggagccatttccaggtgacccggggggactatgcacccatcctccagaaggtggtggag
cacctggagaaagccaaggcgtatgcagccaatagccaccaggagcagatgctggcccag
tacatagaaagcttcacccagggctccattgaggcccacaagaggggctcccgcttctgg
atccaggacaaaggccccatcgtggagagttacatcgggttcatcgagagctaccgcgac
ccttttggttcccgaggagagtttgaaggcttcgtggccatggtgaacaaggccatgagt
gccaagtttgaatggctggtggcaagcgcagagcagctgctgaaggagctgccctggccc
ccagccttcgagaaggacaagttcctcacccccgacttcacctccctggatgttctcacc
ttcgctggctctggcatccccgctggcatcaacatccccaactacgacgacctgaggcag
acggaaggctttaagaacgtgtcactggggaacgtgctggctgtgtcctacaccacgcag
cgggagaagctcaccttcctggaggaggatgacaaggacctgtacatccgctggaagggt
ccctcctttgacgtgcaggtgggactgcacgagctgctgggccatggcagcggcaagctc
ttcgtgcaggatgagaaaggagcattcaactttgaccaggacacggtgatcaaccccgag
accggggagcagattcagagctggtaccggagcggggagacgtgggacagcaagttcagc
accatcgcctccagctacgaagagtgccgggcggagagcgtgggcctctatctctgcctc
aacccccaagtgctggagatctttggctttgagggggctgatgccgaagatgtcatctac
gtgaactggctcaacatggttcgggccgggctgctcgcgctggagttctatacccctgag
accgccagctggagacaggcccacatgcaggcccggtttgtgatcctgagggtcttgctg
gaggctggcgagggactcgtgaccgtcactcccaccacaggctccgatgggcgcccagat
gcccgggtccgtcttgaccgcagcaagatccggtctgtgggcaagcctgccctggagcgg
ttcctgcggagactccaggtgctgaagtccacaggggatgtggccggaggccgggccctg
tacgaggggtatgcggcggtcaccgatgcgccccctgagtgcttccttaccctcagggac
acggtgctgctccgcaaggaatctcgaaagctcattgttcagcctaacactcgcctcgaa
ggctccgaagtgcagcttcttgagtacgaggcctcggcggccggcctcatccaatccttc
tccgagcgcttcccggaggatgggcccgagttggaagaggtcctcacccagctggccaca
gctgatgcgcggttctggaagggccccagtgaggccccatctggccaggcttga

DBGET integrated database retrieval system