KEGG   Equus asinus (ass): 106833598
Entry
106833598         CDS       T04645                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
eai  Equus asinus (ass)
Pathway
eai00100  Steroid biosynthesis
eai01100  Metabolic pathways
Module
eai_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    106833598 (TM7SF2)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     106833598 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 106833598
NCBI-ProteinID: XP_014700359
Position
Un
AA seq 415 aa
MASPQGSLEFGGPLGAAALMLVLPATMFHLLLVARSGPARLLGPPPYLPGPEALWSPRAL
QLVLAWLGLQAALYLLPARKVAEGQELKNKSRLRYPINGFQALVVTTLLVGLGVSAGLPL
DALPEMLLPLAFAATLTAFVFSLLLYLKALVAPASALAPGGNSGNPIYDFFLGRELNPRI
SSFDFKYFCELRPGLMAWVLINLALLLKEAELRGSPSLAMWLVNGFQLLYVADALWHEEA
VLTTMDITHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGLPMASVICLINAIGYYV
FRGANSQKNTFRKNPSDPRVADLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSL
PCGVSHLLPYFYLLYFTALLVHREARDEQQCLQKYGLAWREYCKHVPYRILPYVY
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcttctcctcagggttccctggaattcgggggacctctgggcgctgcggcgctgatg
ctggtgctccctgccaccatgttccacctgctgctggtggcccgctcgggcccagcgcgc
ctcctgggcccacccccctacctgcccggccccgaggcgctgtggagcccgcgggcgctg
cagctcgtgctcgcctggctcggcctgcaggcggcgctctacctactgccggcgcgcaag
gtggccgaggggcaggagttgaagaacaagagtcgcctgcgctaccctattaacggcttc
caggccctggtggtgacaaccctgttggtgggcctgggggtgtcggctgggctgcccctg
gacgcgctcccggaaatgctcctgcccttggcgtttgcggccaccctcaccgccttcgtc
ttcagcctccttctctatctgaaggctctggtagcccctgcctccgccctggcacctggg
ggcaactcaggcaaccccatttacgactttttcctgggacgggagctcaacccgcgcatc
tcttcctttgatttcaaatatttctgcgaacttcggcctggcctcatggcctgggtcctc
atcaacctggccctgctcctgaaggaagcagaacttcggggaagtccgtcactggccatg
tggctggtcaatggcttccagctcctctacgtggctgatgccctctggcatgaggaggct
gtcctcaccaccatggacatcacacacgacgggtttggcttcatgctggcctttggggac
ctagcctgggtacccttcacctacagccttcaggcccagttcctgctgtaccacccgcag
ccgctggggttgccgatggcctcagtcatctgcctcatcaatgctattggctactacgtc
ttccgtggagccaactcccagaaaaacaccttccgaaagaatccgtctgaccccagagtg
gctgaccttgaaaccatacctacagctacggggcgacagctgctggtgtctgggtggtgg
ggaatggtccgccatcccaactaccttggagacctcatcatggctctggcctggtccttg
ccctgcggggtgtcccacctgctgccctacttctacctcctctatttcactgcgctgctg
gtgcaccgtgaggcccgggatgagcagcagtgcctgcagaagtacggcctggcctggcgg
gaatactgcaagcacgtgccttaccgaatcctgccctatgtctactga

DBGET integrated database retrieval system