KEGG   Equus asinus (ass): 106834470Help
Entry
106834470         CDS       T04645                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
eai  Equus asinus (ass)
Pathway
eai00561  Glycerolipid metabolism
eai01100  Metabolic pathways
eai04714  Thermogenesis
eai04723  Retrograde endocannabinoid signaling
eai04923  Regulation of lipolysis in adipocytes
Module
eai_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106834470 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    106834470 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    106834470 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    106834470 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eai01002]
    106834470 (MGLL)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106834470 (MGLL)
Peptidases [BR:eai01002]
 Serine Peptidases
  Family S33
   106834470 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_5 Abhydrolase_3 DLH Peptidase_S9 LIDHydrolase PGAP1 Thioesterase BAAT_C DUF1057
Motif
Other DBs
NCBI-GeneID: 106834470
NCBI-ProteinID: XP_014701588
Position
Un
AA seq 346 aa AA seqDB search
MPPCDRRDEGAAVICLALILEAVVAVECKSQDMMEPGLEDPLTMPEESCLRQTPQKIPYR
DLPHLVNADGLYLFCKYWKPTGTPKALIFVSHGAGEHCGRYDELAQMLVGLGLLVFAHDH
VGHGQSEGERMVVSDFHVFVRDVLQHVDIMQKDYPGIPVFLLGHSMGGAIVILTAAERPG
HFSGMVLISPLVLANPESATTFKVLAAKVLNLVLPNMSLGPIDASMLSRNKTEVDLYNAD
PLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADRLCDSKGAYLLMESSKSQ
DKTLKIYEGAYHVLHKELPEVTNSVFREINMWVSQRTAATERGSPP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctgtgaccgccgagatgagggagcagccgttatttgcctggccctgattctc
gaggctgtcgtggctgtggaatgcaaaagccaggacatgatggaaccagggcttgaggat
cctctcacgatgccggaggaaagttgtctcaggcagaccccgcagaagattccgtaccgg
gacctccctcacctggtcaacgctgacgggctgtacctcttctgcaagtactggaagccg
actggcacacccaaggccctcatctttgtgtcccatggcgctggggaacactgcggccgc
tatgatgagctggctcagatgctggtggggctggggctgctggtgttcgcccacgaccac
gttggccacggacagagcgaaggggagaggatggtcgtgtctgacttccacgttttcgtc
agggacgtgctccagcacgtggatatcatgcagaaagactatcccgggatccctgtcttc
cttctgggccactccatgggaggtgccatcgtcatcctcacagccgcagagaggccaggc
cacttctctggcatggttctcatttcgcctttggttcttgccaatcctgagtcggccacc
actttcaaggtccttgctgcaaaagttctcaaccttgtcctgccaaacatgtccctgggc
ccgattgacgccagcatgctctctcggaataagacggaggtcgacctttataacgcagac
cccctcatctgccgggcagggctgaaggtatgcttcggcatccagcttctcaatgccgtc
tcgcgggtagagcgggccctccccaagctgacgttgcccttcctgctgctccagggctct
gctgaccgcctgtgcgacagcaaaggagcctacttgctcatggagtcctccaagagccag
gacaagacacttaagatttacgaaggtgcctaccacgttctccacaaagagcttcctgaa
gtaaccaactccgtcttccgtgaaatcaacatgtgggtctctcaaaggactgcggcgaca
gagagggggtccccgccctga

DBGET integrated database retrieval system