KEGG   Equus asinus (ass): 106834843Help
Entry
106834843         CDS       T04645                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
eai  Equus asinus (ass)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eai04131]
    106834843 (DOCK8)
Membrane trafficking [BR:eai04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    106834843 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N GPR15L
Motif
Other DBs
NCBI-GeneID: 106834843
NCBI-ProteinID: XP_014702254
Position
Un
AA seq 2102 aa AA seqDB search
MATLPSAERRAFALKINRYSSAEVRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVE
PVDFEGLLMTHLNSLDVELAQELGDFTEDDLDVVFTPKECRTLQPSLPEEGVELDPHVRD
CVQTYIREWLIVNQKNQGSSEICGFKKTGSRKDFHKTLQKQTFESETLEGSEPSAQTGPR
CRLNVLCDVSGKGPLTACDFDLRSLPPDQRLENLLQHVSAEDFEKQNEEARRTNRQAELF
ALYPSVDEEDAVEIRPVPECPKEHLGNRILVKLLTLKFEIEIEPLFASIALYDVKERKKI
SENFHCDLNSDQFKGFLRAHTPSVATSSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIG
DCAEPYMVIKESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLTSFFNVSTLER
EVTDVDSMVGRSTVGERRTLSQSRRLSERALSLEENGVGSNLKTTPITVSSFFKQEGDRL
SDEDLFKFLADYKRSSSLQRRVKSIPGLLRLEISPAPETVSCCLTPEMLPVRPFPENRTR
PHKEILEFPIREVYVPHTVYRNLLYVYPQRLNFANKLASARNITIKIQFMCGEDASNAMP
IIFGKSNGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVHHHLLFTFYHISCQQKQG
ASVESLLGYSWLPILVNERLQTGSYCLPVALEKLPANYSLHSAEKVPLQNPPIKWAEGHK
GVFNIEVQAVSSVHTQDNHLEKFFTLCHSLESQVSFPIRVLDQKISETALEHELKLSIIC
LNSSRLEPLVLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLGK
DQHGRNCLLASYVHYVFRLPELQKDVPKSGGPTALPDPRYHTYGRTSAAAVSSKLLQARV
MSSSNPDLAGTHSAVDEEVKNIMSSKVTDRNCNRMSYYCSGNNDVPSSTTAPRPASKKHF
HEELALQMVVSTGMVRETVFKYAWFFFELLVKSMAQYVHNMDKRDNFRRTRFSDRFKDDI
TTIVNVVTSEIAALLVKPQKENEQAEKINISLAFFLYDLLSLMDRGFVFNLIKHYCNQLS
AKLNNLPTLISMRLEFLRILCSHEHYLNLNLFFMSTDTAPASPCPSISSQNSSSCSSFQD
QKIASMFDLTPEYRQQHFLTGLLFTELAAALDAEGEGISKVQRKAVSAIHSLLSSHDLDP
RCVKPEVKVKIAALYLPLVGIILDALPQLYDFTAADARSGKNRSNGSDEEQEGTSAINQN
VALAIAGSNFNLKTSGTMLSSLPYKQYNMLNADTTRNLMICFLWIMKNADQSLIRKWIAD
LPSMQLNRILDLLFICVSCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEM
MRRCRTPGNDRFPGLNENLRWRKEQTHWRQANEKLDKTKAELDQEALISGNLATEANLII
LDMQENIIQATSALDCKDSLLGGVLRVLVNSLSCDQSTTYLTHCFATLRALIAKFGDLLF
EEEVEQCADLCQRVLHHCSSSMDITRSQACATLYLLMRFSFGATSNFARVKMQVTMSLAS
LVGKAPDFNEEHLRRSLRTILAYAEEDTAMQSTPFPTQVEELLCNLNSILYDTVKMREFQ
EDPEMLMDLMYRIAKSYQTSPDLRLTWLQNMAEKHTKKKCYTEAAMCLVHAAALVAEYLS
MLEDHSYLPVGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAE
LFSTGGLYETVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDSIISKGHKRMFGTYFRV
GFYGSKFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSAPVDKTKLD
PNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNT
VLTTMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAVNQEPPDAKMLQMVL
QGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITA
DQREYQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQ
GS
NT seq 6309 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctgccgagcgcagagcgccgcgccttcgcgctcaagatcaacaggtattct
tcagcggaagtaaggaaacagtttactctgccgccaaatcttggccagtaccatcgacag
agcataagtacctctggcttcccctctcttcaactacctcagttttatgacccggtggag
ccggtggactttgaaggacttctgatgacacacttgaacagcctggatgtggagcttgcc
caggagctgggagacttcactgaagacgacctggacgtggtgttcaccccaaaggaatgt
cgcactttgcagccctctttgccggaggaaggagttgaactggatccacacgtcagggac
tgtgttcagacctacattcgggagtggctaattgtgaaccagaaaaaccaaggaagttcg
gagatttgcggctttaaaaagactggatcccgaaaagattttcacaagacgcttcagaaa
cagacgtttgagtcagaaaccttggagggcagtgagcccagtgcccagacaggcccccgc
tgccgcttaaacgtgctgtgtgatgtgtctggaaaaggtcccctcactgcctgcgacttt
gacctccgcagcctgccgcctgaccagcgtctggaaaacctcctgcagcacgtgagtgcc
gaggacttcgagaagcagaatgaggaggcccgcaggaccaatcggcaggccgagctcttt
gccctttacccatcagtggatgaggaggatgctgtggaaatacgtccggtaccagaatgt
cctaaggaacatctgggcaacagaatattggtcaagttgctgaccctgaagtttgagatt
gaaattgagcctctctttgccagcattgccctctatgatgtcaaagaaaggaaaaagatc
tcagaaaattttcactgtgacctgaactctgaccagttcaagggatttctgcgtgctcac
acgccttctgttgccacgtcaagtcaagcgagatctgcggtgttctcggtcacctacccg
tcctcagacatctacctggtagtcaagattgaaaaagtccttcagcagggagagattgga
gactgcgcagaaccctacatggttatcaaagaaagtgatggtggaaagagtaaagagaag
attgaaaaactaaagcttcaagctgaatctttctgccaacgcttggggaaataccggatg
ccctttgcctgggctcccataagcttaacaagcttcttcaatgtctctaccctggagagg
gaggtaaccgatgtggactccatggttgggagaagcactgtgggtgagcggagaactttg
tctcagtctagaaggctttctgaaagagccctctccttggaggaaaatggggttggctcc
aacttgaagaccacccccataaccgttagcagctttttcaaacaggagggagatcgcctt
agtgatgaagatttattcaagtttttagctgactacaaaagatcttcatccttacagaga
agagtcaagtcaattccaggcttgctcagactggagatttctccagctccagagacagtc
agctgttgtttgactcctgaaatgctaccagtgagaccctttcctgaaaaccggacacgt
ccacacaaagagattttggaatttccaatccgggaggtatatgtccctcacactgtgtac
agaaaccttctctatgtctacccacagaggctgaacttcgctaacaaactagcctctgcc
cggaacattacaataaagatccagttcatgtgtggagaggatgctagcaacgctatgccg
atcatctttgggaaatccaatgggcctgaatttctgcaggaagtatacacagccgttaca
taccataataagtctcctgacttctatgaagaagtgaaaattaagctccccgcgaagctc
acagtacatcaccacctcctgttcaccttctatcatatcagctgtcagcagaagcaagga
gcctccgtggaaagcctcctaggatactcatggctgccaattctcgtaaatgaacgtctt
caaactggatcctactgtctcccagttgccttggaaaagctgcccgccaactactccctg
cattctgcagagaaagtccctttacagaatcctccgattaagtgggccgaaggacataag
ggagtatttaatattgaagtgcaagctgtttcttctgtccacacccaggacaaccacctg
gagaagttcttcaccctctgccactccctggagagccaggtgagcttccctatccgtgtg
ctggaccaaaagatcagtgagacggcgctggagcacgagctgaagctcagcatcatctgc
ctgaactcctcgcgcctggagcccctcgtgctcttcctgcacctggtgctggacaagctc
ttccagctgtccgtgcagcccatggtcatcgctggccagacagccaacttctcccagttt
gcctttgagtccgtggtggccatcgccaacagtctgcacaacagcaaggacctgggcaag
gaccagcacggcaggaactgcctgctggcctcctacgtgcactatgtcttccgcctgccg
gagctgcaaaaggacgtgcccaagtcaggtggccccaccgctctccctgaccctcgctac
cacacatatggacgcacgtctgctgccgctgtgagttcaaagctgctgcaggcccgagtg
atgagcagcagcaacccagacctcgcagggacacattctgcagtagatgaggaagttaag
aacatcatgtcttcaaaggttactgatcgcaactgcaaccggatgtcttactattgctct
ggcaataacgatgttccaagctcaaccacagccccaaggccagccagcaaaaagcatttc
cacgaggagcttgccctgcagatggtcgtcagcaccgggatggtgagagaaacagtcttc
aagtacgcctggttcttctttgagcttctggtgaaaagcatggcccagtatgtacataac
atggacaaacgggacaattttcggaggactcgtttttccgaccgtttcaaagatgacata
actactattgttaatgtggtcacctcggagattgcagcccttttagtaaaacctcagaag
gaaaacgaacaggcggaaaagatcaacatcagcctggctttctttttatatgaccttctc
tcactcatggatcgtggctttgtgtttaacctcatcaaacattactgcaaccagctgtca
gccaagctcaacaaccttccaacgctcatttccatgaggctggagttcttgagaatcctc
tgcagtcacgagcattacctcaatctgaaccttttctttatgagcacggatactgctcca
gcatctccctgtccctccatatcttcccagaactcaagctcctgctccagtttccaggac
cagaagattgccagcatgttcgatctgactccagagtaccgccagcagcactttctcact
ggccttctctttactgaactggctgctgccttggatgctgaaggggaagggatcagcaaa
gtgcaaaggaaagctgtcagtgccatccacagcctgctaagttctcacgacctggacccg
cgttgtgtcaaaccagaggtgaaggtcaaaattgctgccctttacctgccattggttggc
atcattttggatgctttgccgcagctctatgactttacagctgcagatgcccgtagtgga
aaaaatcgctccaatggctcagatgaagaacaagaagggaccagtgccattaaccagaat
gtggcactggccatagctgggagtaattttaatttgaagacgagtggaacaatgctatct
tccttgccctacaagcagtacaacatgctgaacgccgacaccacccgcaacctcatgatt
tgcttcctctggatcatgaaaaatgctgatcagagcctcattaggaagtggattgccgac
ctgccatcgatgcaactgaataggattttagatctccttttcatctgtgtctcatgtttt
gagtacaagggaaagcagagttctgacaaagtgagtacccaggtcctgcagaagtcgagg
gatgtcaaggccaggctggaagaggctttgctccgcggggaaggggccagaggagagatg
atgcggcgctgccggactccagggaatgaccgatttccaggcctaaatgaaaatttgaga
tggaggaaagagcagacacattggcggcaagctaatgagaagctagataaaacaaaggca
gaattagatcaagaagccttaatcagtggcaatctggccacggaagcaaatttaatcatc
ctggatatgcaggaaaacataatccaggcaacctcagctctggactgtaaagacagcctg
ctgggaggtgttctaagggtcctggtgaattctctgagctgtgatcagagcaccacctac
ctgactcattgctttgcgacactccgtgctctcatcgccaagtttggcgacttgctgttt
gaggaggaagtggagcaatgtgcggacctgtgtcagcgcgtgctgcaccattgcagcagc
agcatggacatcacccggagccaagcctgtgccaccctctacctcctcatgagattcagc
tttggggccaccagtaactttgcaagagtgaagatgcaagtaaccatgtctctggcatct
ttagtgggcaaagcaccagactttaatgaggagcacctgagaaggtccttgaggacgatt
ttggcctatgcagaagaggacaccgccatgcagtccactcctttccccacccaggtggaa
gaacttctctgcaatctgaatagcatcttatatgacacagtgaaaatgagggaatttcag
gaagatcctgagatgcttatggatctcatgtacagaattgccaagagttaccagacctct
cctgacctgcggctgacctggctccagaacatggcagagaaacacaccaagaagaagtgc
tacacagaggccgccatgtgcctggtgcacgcggctgccttagtggccgaatatctgagc
atgctggaggaccacagctacctgcccgtgggcagtgtcagctttcagaatatttcttcc
aacgtgctggaggagtcagcggtctctgatgacaccctgtcccctgatgaggatggtgtg
tgctccggccggtacttcaccgagagtggcctggtgggcctcctggagcaggccgcggag
ctcttcagcacgggaggattgtatgagacggttaatgaggtctacaaactggtcatcccc
atcctggaagcacatcgagacttccggaagctgacttccacgcatgacaagctacagaag
gcctttgacagcatcattagcaagggtcataagagaatgtttggaacttacttccgcgtt
ggtttctatggatccaaatttggagatttagatgagcaggaatttgtttacaaagagcct
gcaattaccaagcttcctgagatttctcacagactagagggattttatggtcaatgtttt
ggtgcagaatttgtggaagtgataaaagactccgctcctgtggacaaaaccaagctggat
ccaaacaaggcctacatccagatcacttttgtggagccctactttgatgagtacgagatg
aaagacagggtaacctactttgagaagaatttcaatctgcggaggttcatgtacaccacc
ccgttcaccctggaggggcggccccggggagagctgcatgagcagtaccgtcggaacacc
gtcctgaccaccatgcacgccttcccctacatcaagacccggatcagcgtcatccagaag
gaggagtttgttttgacaccaatcgaagttgccattgaagatatgaaaaagaagaccttg
cagttagcggttgccgttaaccaggagccccctgatgccaagatgcttcagatggtgctg
cagggctccgttggagctactgtaaatcagggaccactggaagtagcccaagtatttttg
gctgaaattcccgctgacccaaaactctatcgacatcacaacaagttgagattatgtttt
aaggaattcataatgcgatgcggtgaggctgtagagaaaaacaagcgtctcatcacggcg
gaccagagggagtatcagcaggaactcaaaaagaactacaacaagctgaaagagaacctc
aggccaatgatcgagcggaaaattccagaactctacaagcctatattcagagttgagagt
caaaagagagactccttccacagatccagtttcaggaaatgtgaaacccagttgtcacag
gggagctaa

DBGET integrated database retrieval system