KEGG   Equus asinus (ass): 106835100
Entry
106835100         CDS       T04645                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
eai  Equus asinus (ass)
Pathway
eai00230  Purine metabolism
eai00240  Pyrimidine metabolism
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106835100 (DCK)
   00240 Pyrimidine metabolism
    106835100 (DCK)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     106835100 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_28 AAA_18 AAA_33 AAA_17 DUF932
Other DBs
NCBI-GeneID: 106835100
NCBI-ProteinID: XP_014702712
Position
Un
AA seq 263 aa
MATPPKKSCLSPTTGSQRTRIKKVSIEGNIAAGKSTFVNILKQVCEDWEVVPEPVTRWCN
VQSTQDEFEELTTVEKTGGNVLQMMYEKPERWSFTFQLYACLSRIRAQFASLNGKLKNAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNKQMGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQDIPLEYLEKLHSKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKYDSLVEKVKEFLNTLSSC
NT seq 792 nt   +upstreamnt  +downstreamnt
atggccaccccacccaagaagagctgcttgtctcccacgaccggctctcagaggacccgc
atcaagaaagtctccatcgaagggaacatcgctgcagggaagtcaacttttgtgaatatt
cttaaacaagtctgtgaggattgggaagtggttcctgagcctgttaccagatggtgcaat
gttcaaagtactcaagatgaatttgaggaattgacaacagttgagaaaactggcgggaat
gttctgcagatgatgtatgagaaacccgaacgatggtcttttaccttccagttatatgcc
tgcctcagtcgaatacgagctcagtttgcctctctcaatggcaagctcaaaaatgcggag
aaaccagtattattttttgagcgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaataaacagatgggccaaagccttgaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaagatatt
cctcttgaatatttagagaagcttcactctaagcatgaaagctggctcctgcatagaaca
ctgaagaccaattttgattatctacaagaagtgcctattttaacactggatgttaatgaa
gactttaaagacaaatatgacagtctggttgaaaaggtcaaagaatttctgaacactttg
tcatcttgctga

DBGET integrated database retrieval system