KEGG   Equus asinus (ass): 106836431Help
Entry
106836431         CDS       T04645                                 

Gene name
DHX8
Definition
(RefSeq) DEAH-box helicase 8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
eai  Equus asinus (ass)
Pathway
eai03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:eai00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106836431 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eai03041]
    106836431 (DHX8)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106836431 (DHX8)
Spliceosome [BR:eai03041]
 Complex C
  Other components
   Step II factors
    106836431 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH Sigma54_activ_2 ABC_tran
Motif
Other DBs
NCBI-GeneID: 106836431
NCBI-ProteinID: XP_014704792
Position
Un
AA seq 1226 aa AA seqDB search
MAVAVAVAGAVNGTDLGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPIVKPKTEKEKLKELFP
VLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAAQEKQRDVEHRDKTKKKKRSRSR
ERDRDRDRDRDRERDRDRDRDRDHKRRHRSRSRSHSRTRERNKGKSRYRSRSRSQSPPKD
RKDRDKYGERNLDRWRDKHVDRPPPEEPAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGL
VHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNL
VGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKE
EFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQ
AAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPND
IPEWKKHAFGGNKASYGKKTQMSIIEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGK
TTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSP
ETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLI
VTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPG
DILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRK
VVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRT
GPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETL
ITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSV
QNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRR
AQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVY
IHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKK
QQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggctgtggccgtggccggagccgtgaacgggacggatctgggccccgcggaa
gaactcgccaaactcgagtacttgtctttagtgtcgaaggtttgcaccgagctggacaat
cacttggggatcaacgacaaggatctggctgaatttgtgatcagtcttgctgagaaaaat
accacctttgatacttttaaggcttctctggtcaaaaatggtgcagaattcacggattct
cttattagtaacttgctgcgtctcatacaaaccatgcgacctccagcgaagccttctact
agcaaagatccaattgttaaacccaaaactgaaaaagaaaagctgaaggaactcttccca
gtgctttgccaaccagacaacccttccgttcggaccatgctggacgaggatgatgtgaaa
gtcgctgtggatgtcctgaaggaactggaggccttaatgcccagcgcggcagcccaggag
aagcaaagagacgttgagcaccgggacaagacaaagaaaaagaagcggagccggagccga
gagcgagaccgcgaccgagatcgagatcgagacagagagcgagaccgagaccgagaccgc
gatagggaccacaagcggagacaccggtcccgctctcggtcacattccaggacccgggag
aggaataaagggaagtctagatatcggtccaggagcagaagtcagagtccccccaaagac
cggaaggaccgagacaagtatggggagaggaatctggacagatggcgggataagcatgtg
gaccgccctcccccggaagagcctgccatcggggacatttacaatggcaaagttaccagc
atcatgcagtttggatgctttgtgcagctggagggactaaggaagcggtgggaaggcctg
gtgcacatctctgagctccggcgggaaggccgtgtggccaatgtggctgatgtggtgagc
aaaggccagagggtcaaggtcaaagtgctgtccttcactgggaccaagaccagcctgagc
atgaaggatgtagatcaagagactggagaagatctaaacccaaatcggcgacgaaatctt
gtcggggagaccaatgaggagacgtcaatgaggaatccggacagacccactcacctctcc
ctcgtcagcgcccctgaagtagaggatgactcgctggagcgcaagcgcctcacccgcatc
tctgacccagagaagtgggagatcaaacagatgatcgctgccaatgtcctttccaaagag
gagtttccagactttgacgaggagaccggcattctccctaaggtggatgatgaagaagat
gaggaccttgagatcgaactggttgaagaagagcctccattcctgagaggacacaccaag
caaagcatggacatgagccctattaagatcgttaagaaccctgatggctccctctcccaa
gcagcgatgatgcagagcgctttggccaaagaaaggcgggaactcaagcaggcccagcgg
gaagccgagatggattctattcccatgggactcaacaaacactgggttgatcctctgcct
gatgcggaaggcaggcagattgctgccaacatgaggggtattgggatgatgcccaatgac
attcccgagtggaagaaacatgcatttgggggcaataaagcttcttatggaaaaaagaca
cagatgtcaatcattgagcagagagagagcctgcccatctacaaactgaaggagcagctg
gtccaggctgtccatgacaatcaaatcctgattgttatcggagagacaggatctgggaag
acaacgcagatcactcagtacctggcggaggcaggctacacttccaggggcaagatcgga
tgtacccagccgagaagagtggcagccatgtcagtggccaagagagtgtcagaggaattt
ggttgttgcttaggccaggaggtgggctacaccattcgatttgaggactgcaccagcccg
gaaacagtcatcaagtacatgacagatgggatgttgctccgagagtgcctgattgacccc
gatctcactcagtacgcgatcatcatgttggatgaggcgcatgagagaacaattcacact
gacgtgctctttgggttgttgaaaaagaccgttcagaaacggcaggacatgaagctgatt
gtcacctcagccaccttggatgcagtgaagttttctcagtacttctacgaggctcccatc
ttcaccatcccaggtcgaacatatccggtggaaatcttgtacacaaaggagcctgagaca
gactatctggacgccagcttgatcacggtcatgcagatccatttaacagaaccgccaggt
gatatcctggtcttcctgactgggcaggaagagatcgatactgcttgtgagatcttgtat
gaaagaatgaaatccctgggacctgatgttcctgagctgattatcctcccagtgtactct
gctcttcccagtgagatgcagacccgaatctttgacccagccccacctggcagcagaaag
gtcgtgattgccaccaacattgctgagacatcgctgactattgacggcatttactatgtg
gtggaccctggattcgtgaagcagaaagtgtataattccaagacagggattgaccagctt
gtggtgacccctatttctcaggctcaggcaaagcaacgagctggcagagctgggagaaca
ggcccggggaagtgttaccggctgtacacagaacgtgcctaccgagatgaaatgctgacc
accaatgtgccggaaatccagagaaccaacttagccagcactgtgctctcgctcaaggcc
atgggcatcaatgacctgctgtcctttgacttcatggatgccccaccaatggaaaccttg
atcacagccatggagcagctgtacactctgggggccctggacgacgagggcctgcttact
cgcctgggccgcaggatggcagaattccccctggagccaatgctgtgcaagatgctgatc
atgtctgtgcatctgggctgcagtgaggaaatgctgaccatcgtgtccatgctgtctgtg
cagaatgtcttctacaggcccaaggataaacaagcccttgcagatcagaagaaggccaaa
ttccaccagaccgaaggggaccacctcaccctgctggccgtgtacaattcctggaagaac
aacaagttctccaacccatggtgctatgagaactttatccaggctcgttccctgcgccgg
gcccaggacattcgcaagcagatgttaggcataatggacagacacaagctggatgtggtc
tcctgtgggaagtccacagtccgagtgcagaaggccatctgcagtggattcttccgaaat
gctgccaagaaagacccgcaggagggttaccggacactgatagaccagcaggtggtctac
atccatccttccagcgcgctcttcaacaggcagccggaatgggtggtgtaccacgagctg
gtgctgaccacgaaggagtacatgcgcgaggtcaccaccatcgacccccgctggctcgtg
gagtttgctcccgcctttttcaaggtctccgacccgaccaagctaagcaagcagaaaaag
cagcagcgccttgaacccttgtacaaccgttatgaggagcccaacgcctggagaatatcc
cgggccttccggcggcgctga

DBGET integrated database retrieval system