KEGG   Equus asinus (ass): 106836628Help
Entry
106836628         CDS       T04645                                 

Gene name
CREM
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
eai  Equus asinus (ass)
Pathway
eai04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:eai00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106836628 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eai03000]
    106836628 (CREM)
Transcription factors [BR:eai03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106836628 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID
Motif
Other DBs
NCBI-GeneID: 106836628
NCBI-ProteinID: XP_014705129
Position
Un
AA seq 391 aa AA seqDB search
MSKCGRKKYFKTNVRQMTMETVESQQDGGVTNSVAESKSAHMQTQTGQNSVPTLAQTLCS
APPPTTILRKTETLHNMQSSNYYKKVSVAGSGTGRGSPAVTLVQLPSGQTVHVRGVIQTP
QPSVIQSPQIQTVQVATIAETDESAESEDVIDSHKRREILSRRPSYRKILNELSSDGPGV
PKIEEEKSEEERTPPHIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALT
MTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQI
RAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNSPQVPSAFLISSRPPSRRR
RRKRTRPERPRSSPGSEVCLPVTRFIILMFL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatgtggcaggaaaaagtattttaagacaaatgtaagacaaatgaccatggaa
acagttgaatctcagcaggatggaggtgtaacaaattctgtggcagagagcaaatctgct
catatgcagacccagactggtcaaaattcagtccctactttagctcagacactgtgcagc
gctcctccccccaccactattctcagaaaaacagaaaccctccacaatatgcaatcctca
aattattataagaaggtctctgtagctggatcaggcaccggaagaggctctccagctgta
actctagtacaattaccctcagggcaaactgtccatgtccggggagtaattcagacccca
cagccatcggttattcagtcaccacaaatacagactgttcaggtagcaacgattgcagag
acagatgagtctgcagaatcagaagatgtaattgattctcataaacgtagagaaatcctt
tcacgaagaccctcttatagaaaaatactgaatgaactttcttctgatgggcctggtgtt
cccaagattgaagaagaaaaatcagaggaagaaagaacgccacctcacatcgctaccatg
gcagtaccgactagcatatatcagactagcacggggcaatacattgctatagcccaaggt
ggaacaatccagatttctaacccaggatctgatggtgttcagggactgcaggcattaaca
atgacaaattcaggagctcctccaccaggtgctacaattgtacagtatgcagcacaatca
gctgatggcacacagcagttctttgtcccaggcagccaggttgttgttcaagatgaggaa
actgaacttgccccaagtcacatggctgctgccactggtgacatgccaacttaccagatc
cgagctcccactactgctttgccacagggggtagtgatggctgcctcaccaggaagtttg
cacagtccccagcaactggcagaagaggcaacacgcaaacgagagctgaggctaatgaaa
aacagcccgcaggttccctccgccttcctcatctcatccaggccaccgagcaggaggagg
aggcggaagcgcacccgccccgagcggccgcggtcctcgccggggtcagaagtctgcctt
cctgtaacccgattcattattcttatgtttctgtaa

DBGET integrated database retrieval system