KEGG   Equus asinus (ass): 106836659Help
Entry
106836659         CDS       T04645                                 

Gene name
DHRS3
Definition
(RefSeq) dehydrogenase/reductase 3
  KO
K11146  short-chain dehydrogenase/reductase 3 [EC:1.1.1.300]
Organism
eai  Equus asinus (ass)
Pathway
eai00830  Retinol metabolism
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    106836659 (DHRS3)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     106836659 (DHRS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 106836659
NCBI-ProteinID: XP_014705237
Position
Un
AA seq 217 aa AA seqDB search
MGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQH
INTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLG
LLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVEAVQLNQALLLLPW
TMHALVILKSILPQAALEEIHKFSGTYTCMNTFKGRT
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgagtgccactacttcatctgtgacgtgggcaaccgggaggaggtgtaccag
acggccaaagctgtccgggagaaggtgggcgacatcaccatcctggtgaacaacgccgcc
gtggtccatgggaagagcctgatggacagcgacgatgatgccctcctgaagtcccagcat
atcaacaccctgggccagttctggaccaccaaggccttcctcccgcgcatgctggagctg
cagaatggccacatcgtgtgtctcaactccgtgctggcgctgtccgccatccccggcgcc
atcgactactgcacgtccaaagcctcggccttcgccttcatggagagcctgaccctgggc
ctgctggactgtccgggcgtcagcgccaccaccgtgctgcccttccacaccagcactgag
atgttccagggcatgagggtcaggttccccaacctcttccccccgctgaagccggagacg
gtggcgcggaggacggtggaagccgtgcagctcaaccaggccctcctcctgctcccgtgg
accatgcacgcccttgtcatcttgaagagcatactcccacaggctgccctcgaggagatc
cacaaattctcaggaacctacacctgcatgaacactttcaaagggcggacataa

DBGET integrated database retrieval system